Q8N720_ZN655 | Zinc finger protein 655
ProteinAtlas
Cosmic
Proviz
Swissmodel
- Reference DB: NESdb:207 validNES:P114
- PMIDs: 15558030
- Species: Homo sapiens (Human)
- Evidence: LMB Sensitive
- Mutation(export): 95RLERLQEILRKFLYL109 by Deletion
- Mutation(bind): Unknown
- Functional seq: 1MEEIPAQEAAGSPRVQFQSLETQSECLSPEPQFVQDTDMEQGLTGDGETREENKLLIPKQKISEEVHSYKVRVGRLKHDITQVPETREVYKSEDRLERLQEILRKFLYLEREFRQITISKETFTSEKNNECHEPEKSFSLDSTIDADQRVLRIQNTDDNDKYDMSFNQNSASGKHEHLNLTEDFQSSECKESLMDLSHLNKWESIPNTEKSYKCDVCGKIFHQSSALTRHQRIHTREKPYKCKECEKSFSQSSSL255
- Sites: 95-109
| # | candidates | uniprotID | start# | sequence | secondary | class | loc_DISO | loc_CDD | beta | Ebind | Score(NES) | Cosmic | Score(Cosmic) | TOTALscore(Ebind|Stars) |
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 1 | nes_diso | Q8N720 | 72 | RVGRLKHDITQVPE .............. |
EECCCCCCCCCCCC | c3-4 | DISO | 0.0 | Bad: -21.445 |  |
| |||
| 2 | ExpNES_diso | Q8N720 | 95 | RLERLQEILRKFLYLER *+++++++++++++*.. |
CCCCCCCHHHHHHHHHH | c1c-5 | DISO | 0.0 | Medium: -39.231  | |
Medium| | |||
| 3 | ExpNES_diso | Q8N720 | 95 | RLERLQEILRKFLY *+++++++++++++ |
CCCCCCCHHHHHHH | c3-4 | DISO | 0.0 | Medium: -37.283 | |
Medium| | |||
| 4 | ExpNES_diso | Q8N720 | 98 | RLQEILRKFLYLER +++++++++++*.. |
CCCCHHHHHHHHHH | c3-4 | DISO | 0.0 | Medium: -37.432 | |
Medium| | |||
| 5 | nes_diso | Q8N720 | 105 | KFLYLEREFRQITISK ++++*........... |
HHHHHHHHHHHHHHHC | c1a-5 | DISO | 0.0 | Medium: -35.141 | |
Medium| |
- candidates: if the segment is located in the disordered or boundary region, flagged with "_diso"; if the segment is located in the ordered region, flagged with "_ord"; if the segment's beta-strand content is over 0.5, flagged with "_beta"; if the segment is annotated as NES in the NESdb or validNES, flagged with "ExpNES_" instead of "nes_".
- sequence: Hydrophobic positions are colored in red.
- class: NES classes 1a, 1b, 1c, 1d, 1aR (reverse class of 1a), 1cR, 2, 2-rev (Rev type class 2), 3, and 4. The first letter "c" is for "class", and the number after hyphen ("-") is for the number of key hydrophobic positions. For example, c1a-4 means class 1a with the non-hydrophobic phi0 position. c1a-5 is for class 1a which have all hydrophobic residues in their phi0-4 positions.
- loc_DISO: location of the segment with respect to the ordered/disordered regions
- loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
- beta: beta-strand content in the middle of the segment
- Ebind: binding energy; Strong (less than -40.0), Medium (-40.0~-33.0), Weak (-33.0~-30.0), or Bad (higher than -30.0); Generated models can be downloaded via icon.
- Score(NES): how many passes for the criteria: i) not located in the ordered region, ii) do not have beta strand in the middle, and iii) Strong, Medium, or Weak Ebind scores
- Cosmic: if the key hydrophobic residues are mapped to the COSMIC mutation position, flagged with "cosmic_phi"; when the changed amino acid of the mutation position is L, I, V, M, or F, flagged with "cosmic_phi_to_LIVMF"; if the spacer residues are mapped to the mutation position, flagged with "cosmic_spacer"
- Score(Cosmic): 2 stars with "cosmic_phi" and the changed amino acid is not L, I, V, M, or F; 1 star for "cosmic_phi_to_LIVMF" or "cosmic_spacer" (Score(Cosmic) is present for only segments with the 3 stars of Score(NES))
- TOTALscore: Score(NES)+Score(Cosmic); The Ebind category (Strong, Medium, or Weak) is annotated together.