HOME Exp-NES Cancer-NES Human-NES Documentation Contact
Q9Y3I1_FBX7 | F-box only protein 7   ProteinAtlas   Cosmic   Proviz   Swissmodel
  • Reference DB: NESdb:230
  • PMIDs: 21378169
  • Species: Homo sapiens (Human)
  • Evidence: LMB Sensitive, Binds CRM1
  • Mutation(export): L332A/L335A/L337A/L339A/L341A
  • Mutation(bind): 332LVVLPLELKLRIFRLLDVRSVLSLSAVCRDLFTASNDPLLWRFL375 by Deletion
  • Functional seq: 332LVVLPLELKL341
  • Sites: -


# candidates uniprotID start# sequence secondary class loc_DISO loc_CDD beta Ebind Score(NES) Cosmic Score(Cosmic) TOTALscore(Ebind|Stars)
1 nes_diso Q9Y3I1 65 SYGIVSGDLICLILQD HCCCCCCCEEEEEECC c1a-4 boundary boundary|Ubiquitin_like_fold superfamily; 0.43 Strong: -40.189 Strong|
2 nes_diso Q9Y3I1 195 ANDALIVLIHLLMLES HHHHHHHHHHHHHHHC c1a-4 boundary boundary|PI31_Prot_N superfamily; 0.0 Medium: -35.917 cosmic_phi_to_LIVMF Medium|
3 low complexity Q9Y3I1 196 NDALIVLIHLLMLE HHHHHHHHHHHHHH c2-4 boundary boundary|PI31_Prot_N superfamily; 0.0 Medium: -33.84 cosmic_spacer
4 low complexity Q9Y3I1 197 DALIVLIHLLMLES HHHHHHHHHHHHHC c2-4 boundary boundary|PI31_Prot_N superfamily; 0.0 Weak: -31.735 cosmic_phi_to_LIVMF
5 nes_ord Q9Y3I1 249 TLTCVPLGNLIVVN EEEEEECCCEEEEE c2-5 ORD middle|PI31_Prot_N superfamily; 0.57 Strong: -41.147 cosmic_spacer
6 nes_beta_diso Q9Y3I1 267 INNEIRSVKRLQLLP ECCEEEEEEEEEECH c1b-4 boundary middle|PI31_Prot_N superfamily; 1.0 Bad: -17.796 cosmic_spacer
7 nes_diso Q9Y3I1 293 NVANIYKDLQKLSR CCHHHHHHHHHHHH c3-4 __ boundary|PI31_Prot_N superfamily; 0.0 Medium: -33.926 Medium|
8 nes_diso Q9Y3I1 312 LVYPLLAFTRQALNLPD CHHHHHHHHHHHCCCCC c1c-AT-5 boundary boundary|PI31_Prot_N superfamily; 0.0 NA cosmic_spacer
9 ExpNES_ord Q9Y3I1 322 QALNLPDVFGLVVLPL
          *++*+*		 HHCCCCCCCCHHHCCH c1a-4 ORD boundary|PI31_Prot_N superfamily; 0.0 Medium: -39.975 cosmic_spacer
10 low complexity Q9Y3I1 325 NLPDVFGLVVLP
       *++*+		 CCCCCCCHHHCC c2-rev ORD boundary|PI31_Prot_N superfamily; 0.0 Weak: -32.488
11 ExpNES_ord Q9Y3I1 333 VVLPLELKLRIFRLLD
++*+*+*+*       		 HHCCHHHHHHHHCCCC c1a-5 ORD boundary|PI31_Prot_N superfamily; 0.0 Weak: -30.408 cosmic_spacer
12 nes_ord Q9Y3I1 342 RIFRLLDVRSVLSLSA HHHCCCCHHHHHHHHH c1aR-4 ORD boundary|PI31_Prot_N superfamily; small|F-box-like; 0.0 Medium: -35.077 cosmic_spacer
13 nes_ord Q9Y3I1 351 SVLSLSAVCRDLFTAS HHHHHHHHCHHHHHHH c1aR-4 ORD boundary|PI31_Prot_N superfamily; small|F-box-like; 0.0 Medium: -38.331
14 nes_diso Q9Y3I1 453 TLPYVGDPISSLIP CCCCCCCCCCCCCC c3-4 boundary 0.0 Bad: -28.134 cosmic_spacer_Pro
  • candidates: if the segment is located in the disordered or boundary region, flagged with "_diso"; if the segment is located in the ordered region, flagged with "_ord"; if the segment's beta-strand content is over 0.5, flagged with "_beta"; if the segment is annotated as NES in the NESdb or validNES, flagged with "ExpNES_" instead of "nes_".
  • sequence: Hydrophobic positions are colored in red.
  • class: NES classes 1a, 1b, 1c, 1d, 1aR (reverse class of 1a), 1cR, 2, 2-rev (Rev type class 2), 3, and 4. The first letter "c" is for "class", and the number after hyphen ("-") is for the number of key hydrophobic positions. For example, c1a-4 means class 1a with the non-hydrophobic phi0 position. c1a-5 is for class 1a which have all hydrophobic residues in their phi0-4 positions.
  • loc_DISO: location of the segment with respect to the ordered/disordered regions
  • loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
  • beta: beta-strand content in the middle of the segment
  • Ebind: binding energy; Strong (less than -40.0), Medium (-40.0~-33.0), Weak (-33.0~-30.0), or Bad (higher than -30.0); Generated models can be downloaded via icon.
  • Score(NES): how many passes for the criteria: i) not located in the ordered region, ii) do not have beta strand in the middle, and iii) Strong, Medium, or Weak Ebind scores
  • Cosmic: if the key hydrophobic residues are mapped to the COSMIC mutation position, flagged with "cosmic_phi"; when the changed amino acid of the mutation position is L, I, V, M, or F, flagged with "cosmic_phi_to_LIVMF"; if the spacer residues are mapped to the mutation position, flagged with "cosmic_spacer"
  • Score(Cosmic): 2 stars with "cosmic_phi" and the changed amino acid is not L, I, V, M, or F; 1 star for "cosmic_phi_to_LIVMF" or "cosmic_spacer" (Score(Cosmic) is present for only segments with the 3 stars of Score(NES))
  • TOTALscore: Score(NES)+Score(Cosmic); The Ebind category (Strong, Medium, or Weak) is annotated together.