HOME Exp-NES Cancer-NES Human-NES Documentation Contact
Q9Y572_RIPK3 | Receptor-interacting serine/threonine-protein kinase 3   ProteinAtlas   Cosmic   Proviz   Swissmodel
  • Reference DB: NESdb:32 validNES:P128
  • PMIDs: 15208320
  • Species: Homo sapiens (Human)
  • Evidence: LMB Sensitive
  • Mutation(export): L255A/L258A/L261A/L264A, M344A/L349A/L352A/L354A
  • Mutation(bind): Unknown
  • Functional seq: 224TEPSLVYEAVCNRQNRPSLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVF287,333TIENQHSRNDVMVSEWLNKLNLEEPP358
  • Sites: 255-264; 344-354


# candidates uniprotID start# sequence secondary class loc_DISO loc_CDD beta Ebind Score(NES) Cosmic Score(Cosmic) TOTALscore(Ebind|Stars)
1 nes_ord Q9Y572 59 REVKAMASLDNEFVLRL HHHHHHHHCCCCCEEEE c1c-AT-4 ORD middle|S_TKc; middle|PKc_like superfamily; 0.0 NA cosmic_spacer
2 nes_ord Q9Y572 60 EVKAMASLDNEFVLRL HHHHHHHCCCCCEEEE c1d-5 ORD middle|S_TKc; middle|PKc_like superfamily; 0.0 NA cosmic_phi_to_LIVMF
3 nes_beta_ord Q9Y572 71 FVLRLEGVIEKVNWDQ CEEEEEEEEECCCCCC c1aR-4 ORD middle|S_TKc; middle|PKc_like superfamily; 0.86 Bad: -25.339 cosmic_spacer
4 nes_beta_ord Q9Y572 71 FVLRLEGVIEKVNW CEEEEEEEEECCCC c3-4 ORD middle|S_TKc; middle|PKc_like superfamily; 1.0 Bad: -22.26 cosmic_spacer
5 low complexity Q9Y572 112 RPWPLLCRLLKEVVLGM CCHHHHHHHHHHHHHHH c1c-4 ORD middle|S_TKc; middle|PKc_like superfamily; 0.0 Bad: -27.006
6 nes_ord Q9Y572 113 PWPLLCRLLKEVVLGM CHHHHHHHHHHHHHHH c1a-4 ORD middle|S_TKc; middle|PKc_like superfamily; 0.0 Medium: -33.714
7 nes_ord Q9Y572 117 LCRLLKEVVLGMFYLHD HHHHHHHHHHHHHHHHH c1c-4 ORD middle|S_TKc; middle|PKc_like superfamily; 0.0 Medium: -33.997 cosmic_spacer
8 nes_ord Q9Y572 120 LLKEVVLGMFYLHD HHHHHHHHHHHHHH c2-5 ORD middle|S_TKc; middle|PKc_like superfamily; 0.0 Medium: -38.574 cosmic_spacer
9 nes_ord Q9Y572 120 LLKEVVLGMFYLHD HHHHHHHHHHHHHH c3-4 ORD middle|S_TKc; middle|PKc_like superfamily; 0.0 Medium: -39.98 cosmic_spacer
10 nes_diso Q9Y572 150 LDPELHVKLADFGLST CCCCCCCCCCCCCCCE c1a-4 boundary middle|S_TKc; middle|PKc_like superfamily; 0.0 Weak: -30.76 cosmic_spacer Weak|
11 nes_diso Q9Y572 152 PELHVKLADFGLST CCCCCCCCCCCCCE c2-4 boundary middle|S_TKc; middle|PKc_like superfamily; 0.0 Medium: -33.017 cosmic_spacer Medium|
12 nes_diso Q9Y572 196 RKASTASDVYSFGILM CCCCCCCCHHHHHHHH c1a-AT-4 boundary middle|S_TKc; middle|PKc_like superfamily; 0.0 NA cosmic_spacer
13 ExpNES_diso Q9Y572 251 ETPGLEGLKELMQLCW
++++*++*++*++*++		 CCCCHHHHHHHHHHHH c1d-4 boundary boundary|S_TKc; boundary|PKc_like superfamily; 0.0 Medium: -39.665 Medium|
14 nes_diso Q9Y572 297 AVSTVKDFLSQLRS HHHHHHHHHHHHHH c3-4 boundary boundary|S_TKc; boundary|PKc_like superfamily; 0.0 Bad: -29.383
15 ExpNES_diso Q9Y572 341 NDVMVSEWLNKLNLEE
+++*++++*++*+*++		 CCHHHHHHHHHCCCCC c1a-4 DISO 0.0 Medium: -34.949 Medium|
  • candidates: if the segment is located in the disordered or boundary region, flagged with "_diso"; if the segment is located in the ordered region, flagged with "_ord"; if the segment's beta-strand content is over 0.5, flagged with "_beta"; if the segment is annotated as NES in the NESdb or validNES, flagged with "ExpNES_" instead of "nes_".
  • sequence: Hydrophobic positions are colored in red.
  • class: NES classes 1a, 1b, 1c, 1d, 1aR (reverse class of 1a), 1cR, 2, 2-rev (Rev type class 2), 3, and 4. The first letter "c" is for "class", and the number after hyphen ("-") is for the number of key hydrophobic positions. For example, c1a-4 means class 1a with the non-hydrophobic phi0 position. c1a-5 is for class 1a which have all hydrophobic residues in their phi0-4 positions.
  • loc_DISO: location of the segment with respect to the ordered/disordered regions
  • loc_CDD: location of the segment with respect to the conserved region annotated in the Conserved Domain Database (CDD)
  • beta: beta-strand content in the middle of the segment
  • Ebind: binding energy; Strong (less than -40.0), Medium (-40.0~-33.0), Weak (-33.0~-30.0), or Bad (higher than -30.0); Generated models can be downloaded via icon.
  • Score(NES): how many passes for the criteria: i) not located in the ordered region, ii) do not have beta strand in the middle, and iii) Strong, Medium, or Weak Ebind scores
  • Cosmic: if the key hydrophobic residues are mapped to the COSMIC mutation position, flagged with "cosmic_phi"; when the changed amino acid of the mutation position is L, I, V, M, or F, flagged with "cosmic_phi_to_LIVMF"; if the spacer residues are mapped to the mutation position, flagged with "cosmic_spacer"
  • Score(Cosmic): 2 stars with "cosmic_phi" and the changed amino acid is not L, I, V, M, or F; 1 star for "cosmic_phi_to_LIVMF" or "cosmic_spacer" (Score(Cosmic) is present for only segments with the 3 stars of Score(NES))
  • TOTALscore: Score(NES)+Score(Cosmic); The Ebind category (Strong, Medium, or Weak) is annotated together.