Protein Domain ID: d1llaa3
Superfamily ID: b.1.18
Number of Sequences: 75
Sequence Length: 241
Structurally conserved residues: 51
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241
| | | | | | | | | | | | | | | | | | | | | | | | |
00000001146676788886421266665000000000000000000000000000016789**999998442336799*9**98643111111110011025778898766554345899999820000000000000000000000000000000016677521126899****9964432000000000000000000000000000000000000000111124899**99887532
d1llaa3: PYDHDVLNFPDIQVQDVTLHARVDNVVHTFMREQELELKHGINPGNARSIKARYYHLDHEPFSYAVNVQNNSASDKHATVRIFLAPKYDELGNEIKADELRRTAIELDKFKTDLHPGKNTVVRHSLDSSVTLSHQPTFEDLLHGVGLSEYCSCGWPSHLLVPKGNIKGMEYHLFVMLTDWDKDKVSVACVDAVSYCGARDHKYPDKKPMGFPFDRPIHTEHISDFLTNNMFIKDIKIKFHE
d1p7hl1: ---------ELP