Protein Domain ID: d1uaia_
Superfamily ID: b.29.1
Number of Sequences: 56
Sequence Length: 223
Structurally conserved residues: 112
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221
| | | | | | | | | | | | | | | | | | | | | | |
01223332224555566542111111221100000000111256665336688888664320001111257999999321112488883246999999999988522147999999999989999****989999889977676999966888789*******989999999888888899899999999996665641111111013457999999**9987
d1uaia_: EPCDYPAQQLDLTDWKVTLPIGSSGKPSEIEQPALDTFATAPWFQVNAKCTGVQFRAAVNGVTTSGSGYPRSELREMTDGGEEKASWSATSGTHTMVFREAFNHLPEVKPHLVGAQIHDGDDDVTVFRLEGTSLYITKGDDTHHKLVTSDYKLNTVFEGKFVVSGGKIKVYYNGVLQTTISHTSSGNYFKAGAYTQANCSNSSPCSSSNYGQVSLYKLQVTHS
d1nlsa_: ------------------------------