Protein Domain ID: d1e5ra_
Superfamily ID: b.82.2
Number of Sequences: 21
Sequence Length: 260
Structurally conserved residues: 95
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231 241 251
| | | | | | | | | | | | | | | | | | | | | | | | | |
88999898998654556666666565654422221345666632233443445578788887789589*******9998889****985*******8**9659*****************************98799999999999876540000000000000000000000000000000000000000000000000000000000000000000000000000001100000000000000000111111000000
d1e5ra_: MRSHILGKIELDQTRLAPDLAYLAAVPTVEEFSNGFWKHVPLWNAPTAHVEHVPYLKEIVTTVFDGTHLQMARSRNLKNAIVIPHRDFRYFRTFMVLEDSPLAFHSNEDTVIHMRPGEIWFLDAATVHSAVNFSEISRQSLCVDFAFDGPFDEKEIFADATLYAPGSTPDLPERRPFTAEHRRRILSLGQVIERENFRDILFLLSKVHYKYDVHPSETYDWLIEISKQAGDEKMVVKAEQIRDFAVEARALSE