Protein Domain ID: d2dpwa1
Superfamily ID: c.68.1
Number of Sequences: 32
Sequence Length: 231
Structurally conserved residues: 124
Alignment with gaps removed from the target domain
Show alignments with gaps
Helix | Strand | Loop | SCR
1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 151 161 171 181 191 201 211 221 231
| | | | | | | | | | | | | | | | | | | | | | | |
47******88666554233343789965555589*******9***********99999767668999988***999999999999*******9968998879999998988999****9764000000222455655554557799*******99**99987676677665420000000000000000000000000212543557789****88988459999877665
d2dpwa1: MRPSAIVLAGGKEAWAERFGVGSKALVPYRGRPMVEWVLEALYAAGLSPVYVGENPGLVPAPALTLPDRGGLLENLEQALEHVEGRVLVATGDIPHLTEEAVRFVLDKAPEAALVYPIVPKEAVEARFPRTKRTYARLREGTFTGGNLLLLDKSLFRKALPLARRVVALRKRPLALARLVGWDVLLKLLLGRLSLAEVEARAQRILGVEARALVTPYPEVGVDVDREEDLV
d1qg8a_: PKVSVIMTSY------------