A0A096LP55 QCR6L_HUMAN
Gene name: UQCRHL
Protein name: Cytochrome b-c1 complex subunit 6-like, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- generation of precursor metabolites and energy GO:0006091
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P24385 | CCND1 | 0.9883 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 2 | P49642 | PRIM1 | 0.82075 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 3 | Q9H4B7 | TUBB1 | 0.79999 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 4 | Q9BVA1 | TUBB2B | 0.7859 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 5 | Q8N3F0 | MTURN | 0.78498 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 6 | Q7LGC8 | CHST3 | 0.7682 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 small molecule metabolic process GO:0044281 |
| 7 | Q7Z5L7 | PODN | 0.75109 | cell population proliferation GO:0008283 |
| 8 | O95456 | PSMG1 | 0.74861 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 cellular component assembly GO:0022607 ... |
| 9 | Q9NT62 | ATG3 | 0.72952 | catabolic process GO:0009056 cell death GO:0008219 cellular component assembly GO:0022607 ... |
| 10 | Q92748 | THRSP | 0.71776 | biosynthetic process GO:0009058 transmembrane transport GO:0055085 transport GO:0006810 |
20 40 60 80 AA: MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK STMI: TTTTTTTTTTTTT DO_DISOPRED3: DD.DDDDDDDDDDDDDDDDDDDDDD.................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.....................DDDDDDDD.DD........................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD................................................................ CONSENSUS: DDDDDDDDDDDDDD................................................................ CONSENSUS_MOBI: DDDDDDDDDDDDDDDDD............................................................. RICH_fLPS_[E]: pEEEEEEEEE RICH_fLPS_MOBI_[E]: gdpEEEEEEEEElvd