Q92748 THRSP_HUMAN
Gene name: THRSP
Protein name: Thyroid hormone-inducible hepatic protein
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q8NCJ5 | SPRYD3 | 0.99818 | cytoskeleton organization GO:0007010 signal transduction GO:0007165 |
| 2 | O95456 | PSMG1 | 0.99695 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 cellular component assembly GO:0022607 ... |
| 3 | Q9UL42 | PNMA2 | 0.99105 | cell death GO:0008219 |
| 4 | Q8N3F0 | MTURN | 0.99027 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 5 | Q9BVA1 | TUBB2B | 0.99017 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 6 | Q9H4B7 | TUBB1 | 0.9786 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 7 | Q969Q1 | TRIM63 | 0.97388 | catabolic process GO:0009056 cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 8 | A6NMX2 | EIF4E1B | 0.96674 | |
| 9 | O43868 | SLC28A2 | 0.94259 | cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 homeostatic process GO:0042592 ... |
| 10 | O95633 | FSTL3 | 0.93925 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
20 40 60 80 100 AA: MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVED STMI: DO_DISOPRED3: DDDDD..............................................................................DDDDDDDDDDDDDDDDD DO_IUPRED2A: ...........................................DD..D................................DDDDDDDDDDDDDDDDDDDD DO_SPOTD: DDDDDDDD..................................DDDDDDDDDD........................DDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDD......................................DDDDD................................DDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..................................................................................DDDDDDDDDDDDDDDDDD RICH_[E]: EEngtaEtEEvEd RICH_fLPS_[E]: sEEngtaEtEEvEd RICH_MOBI_[E]: EEngtaEtEEvEd RICH_fLPS_MOBI_[E]: sEEngtaEtEEvEd
120 140 AA: ESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW STMI: DO_DISOPRED3: DDDDD......................................... DO_IUPRED2A: DDDDDD............................D........... DO_SPOTD: DDDDDDD..................................DDDDD CONSENSUS: DDDDDD........................................ CONSENSUS_MOBI: DDDD.......................................... RICH_[E]: EsasgE RICH_fLPS_[E]: EsasgE RICH_MOBI_[E]: E RICH_fLPS_MOBI_[E]: E