Q8N3F0 MTURN_HUMAN

Gene name: MTURN
Protein name: Maturin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9BVA1 TUBB2B 0.99993 anatomical structure development GO:0048856
cell cycle GO:0007049
cell differentiation GO:0030154
...
2 Q92748 THRSP 0.99027 biosynthetic process GO:0009058
transmembrane transport GO:0055085
transport GO:0006810
3 Q8NCJ5 SPRYD3 0.98892 cytoskeleton organization GO:0007010
signal transduction GO:0007165
4 O95456 PSMG1 0.98689 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cellular component assembly GO:0022607
...
5 Q9H4B7 TUBB1 0.98424 cell cycle GO:0007049
cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
...
6 Q9UL42 PNMA2 0.98328 cell death GO:0008219
7 Q969Q1 TRIM63 0.96594 catabolic process GO:0009056
cellular protein modification process GO:0006464
signal transduction GO:0007165
8 A6NMX2 EIF4E1B 0.94709
9 P49642 PRIM1 0.9436 biosynthetic process GO:0009058
cell cycle GO:0007049
cellular nitrogen compound metabolic process GO:0034641
...
10 O95633 FSTL3 0.93598 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...

                                           20                  40                  60                  80                 100
AA:                      MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSESEDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLP
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                          120         
AA:                      DADDDAFEEYSADVEEEEPEADHPQMGVSQQ
STMI:                                                   
DO_DISOPRED3:            ....DDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ......DDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ....DDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ......DDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[E]:                       EEysadvEEEEpE           
RICH_fLPS_[E]:               dafEEysadvEEEEpEadhp       
RICH_MOBI_[E]:                  EEysadvEEEEpE           
RICH_fLPS_MOBI_[E]:            fEEysadvEEEEpEa