A0A1B0GTB2 A0A1B0GTB2_HUMAN

Gene name: TUNAR
Protein name: HCG2038094, isoform CRA_a

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O00291 HIP1 0.89502 cell death GO:0008219
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
2 Q96PH6 DEFB118 0.8732 cell adhesion GO:0007155
immune system process GO:0002376
reproduction GO:0000003
...
3 Q86XA9 HEATR5A 0.86202 transport GO:0006810
vesicle-mediated transport GO:0016192
4 Q5T3U5 ABCC10 0.85493 transmembrane transport GO:0055085
transport GO:0006810
5 Q7Z5W3 BCDIN3D 0.84033 cellular nitrogen compound metabolic process GO:0034641
6 O00237 RNF103 0.81797 anatomical structure development GO:0048856
catabolic process GO:0009056
cellular protein modification process GO:0006464
...
7 O95990 FAM107A 0.8078 cell adhesion GO:0007155
cell cycle GO:0007049
cell junction organization GO:0034330
...
8 P41214 EIF2D 0.7995 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
cellular component assembly GO:0022607
...
9 P24593 IGFBP5 0.76232 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 P30519 HMOX2 0.75858 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
homeostatic process GO:0042592
...

                                           20                  40            
AA:                      MVITSENDEDRGGQEKESKEESVLAMLGIIGTILNLIVIIFVYIYTTL
STMI:                                                                    
DO_DISOPRED3:            DDDDDDDDDDDDDDDDD...............................
DO_IUPRED2A:             .DDDDDDDDDDDDDDDD...............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDD..............DD.DDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDD...............................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDD............................
RICH_MOBI_[E]:                EndEdrggqEkEskE