Q96PH6 DB118_HUMAN

Gene name: DEFB118
Protein name: Beta-defensin 118

List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- immune system process GO:0002376
- reproduction GO:0000003
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q6I9Y2 THOC7 0.97853 biological process involved in symbiotic interaction GO:0044403
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
2 Q5T3U5 ABCC10 0.97478 transmembrane transport GO:0055085
transport GO:0006810
3 Q9NW15 ANO10 0.95746 transmembrane transport GO:0055085
transport GO:0006810
4 P30519 HMOX2 0.9206 catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
homeostatic process GO:0042592
...
5 Q7Z5W3 BCDIN3D 0.91676 cellular nitrogen compound metabolic process GO:0034641
6 Q16048 PMCHL1 0.89957 cell-cell signaling GO:0007267
7 P13995 MTHFD2 0.8732 cellular nitrogen compound metabolic process GO:0034641
small molecule metabolic process GO:0044281
8 A0A1B0GTB2 TUNAR 0.8732
9 O00291 HIP1 0.86714 cell death GO:0008219
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
10 Q9HCE1 MOV10 0.86489 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...

                                           20                  40                  60                  80                 100
AA:                      MKLLLLALPMLVLLPQVIPAYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKK
STMI:                    SSSSSSSSSSSSSSSSSSS                                                                                 
DO_DISOPRED3:            DDDDDDDDDDDD...................................................................................DDDDD
DO_IUPRED2A:             .............................................................D..DDDDDDDDDD.D.......................D
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD....................................DDDDDDDDDDDDDDDDDDDDD...........DD.DDDDDD
CONSENSUS:                                  ..........................................DDDDDDDDDDDDDDD...................DDDDD
CONSENSUS_MOBI:                             ................................................................................D

                                          120                 
AA:                      DMVEESEAGRGTETSLPNVHHSS
STMI:                                           
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDD
RICH_[E]:                   EEsEagrgtE          
RICH_MOBI_[E]:              EEsEagrgtE