O95990 F107A_HUMAN
Gene name: FAM107A
Protein name: Actin-associated protein FAM107A
List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- cell cycle GO:0007049
- cell junction organization GO:0034330
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- growth GO:0040007
- mitotic cell cycle GO:0000278
- nervous system process GO:0050877
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A0A1B0GTB2 | TUNAR | 0.8078 | |
| 2 | P13995 | MTHFD2 | 0.8078 | cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 3 | O00291 | HIP1 | 0.723 | cell death GO:0008219 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 4 | Q8TBC4 | UBA3 | 0.72028 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular nitrogen compound metabolic process GO:0034641 ... |
| 5 | Q96PH6 | DEFB118 | 0.70537 | cell adhesion GO:0007155 immune system process GO:0002376 reproduction GO:0000003 ... |
| 6 | P24593 | IGFBP5 | 0.69975 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 7 | Q86XA9 | HEATR5A | 0.69634 | transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 8 | Q8IY84 | NIM1K | 0.69137 | cellular protein modification process GO:0006464 signal transduction GO:0007165 |
| 9 | Q5T3U5 | ABCC10 | 0.69061 | transmembrane transport GO:0055085 transport GO:0006810 |
| 10 | O43508 | TNFSF12 | 0.68128 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MYSEIQRERADIGGLMARPEYREWNPELIKPKKLLNPVKASRSHQELHRELLMNHRRGLGVDSKPELQRVLEHRRRNQLIKKKKEELEAKRLQCPFEQEL STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD.........................................................DDDDDDDDD............. DO_IUPRED2A: ............D..DD.....D..........DDDDDDDDD.DDDDDDDDDDDDDDDDD..DDDDDDD..DDDDD.D..DDD.D............... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDD...............................................DDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD...................................................DDDDDDDDDDDDD............. CONSENSUS_MOBI: .................................................................................................... RICH_[R]: ReRadigglmaRpeyR RICH_[ER]: EiqRERadigglmaRpEyRE
120 140 AA: LRRQQRLNQLEKPPEKEEDHAPEFIKVRENLRRIATLTSEEREL STMI: DO_DISOPRED3: ...................................DDDDDDDDD DO_IUPRED2A: ...DDDDDDDDDDDDDDDDDDDDD.................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD........D..DDDDDDDDDDDD CONSENSUS: ...DDDDDDDDDDDDDDDDDD..............DDDDDDDDD CONSENSUS_MOBI: ....DDDDDDDDDDDDDDDDDDDD.................... RICH_MOBI_[E]: EkppEkEEdhapE