List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q96NB1	CEP20	0.92501	cellular component assembly GO:0022607 cytoskeleton organization GO:0007010
2	Q5XG85	n/a	0.92492
3	Q6QEF8	CORO6	0.9222	cytoskeleton organization GO:0007010
4	A8MTB9	CEACAM18	0.92047
5	Q9NRA2	SLC17A5	0.91503	transport GO:0006810
6	Q9NRC8	SIRT7	0.9088	biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell cycle GO:0007049 ...
7	Q9BT56	SPX	0.90713	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 ...
8	A0A1B0GTQ4	MYMX	0.89591	anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell differentiation GO:0030154 ...
9	Q8IYR6	TMEFF1	0.88488	anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ...
10	Q8TAU3	ZNF417	0.85033	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641

                                           20                  40                  60                  80      
AA:                      MRKLRLRASNPGPSGAPGTRQHFSTSRGGHHCARRWLRRVRRSRSQTPSYQNLDPNPPIVRFPLPLERISEVPRRACLHGRDASSVWPPPERSD
STMI:                                                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDD.DD.......................................................................DDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDD..DDDDDD......DDDD...DDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD.DDDD................DDDDDD..............................DDDDDDD..DDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDD................DDDDDD..............................DDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............................................................
RICH_[R]:                 RklRlRasnpgpsgapgtR                                                                          
RICH_MOBI_[H]:                                HfstsrggHH                                                               
RICH_MOBI_[R]:            RklRlRasnpgpsgapgtR