A0A1B0GW64 SIM33_HUMAN

Gene name: SMIM33
Protein name: Small integral membrane protein 33

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9NPA2 MMP25 0.94038 anatomical structure development GO:0048856
catabolic process GO:0009056
extracellular matrix organization GO:0030198
...
2 Q15628 TRADD 0.93924 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell death GO:0008219
...
3 Q8TF74 WIPF2 0.93584 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
4 P04180 LCAT 0.89328 biosynthetic process GO:0009058
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
5 Q92558 WASF1 0.879 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
6 A0A0U1RRE5 NBDY 0.87097 catabolic process GO:0009056
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
7 A0A1B0GUX0 ATP6V1FNB 0.86416
8 Q9BTD3 TMEM121 0.85615
9 O43516 WIPF1 0.84786 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
10 Q8N967 LRTM2 0.83567 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...

                                           20                  40                  60                  80                 100
AA:                      MHQAGHYSWPSPAVNSSSEQEPQRQLPEVLSGTWEQPRVDGLPVVTVIVAVFVLLAVCIIVAVHFGPRLHQGHATLPTEPPTPKPDGGIYLIHWRVLGPQ
STMI:                                                              MMMMMMMMMMMMMMMMMMMMM                                     
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDD............................................................................
DO_IUPRED2A:             ........DDDDDDDDDDDDDDDDDDDDDDDDD.....................................DDDDDDDDDDDDD.D..............D
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDD.........................................................................D
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDD................                     ....................................D
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDD..............                     ...................................DD
RICH_MOBI_[P]:                                                                                                             Pq

                                          120        
AA:                      DSPEEAPPGPLVPGSCPAPDGPRPSIDEVTCL
STMI:                                                    
DO_DISOPRED3:            ........DDDDDD..................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDD..DDD...
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDD...
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[P]:                  PeeaPPgPlvPgscPaPdgPrP        
RICH_fLPS_[P]:             PeeaPPgPlvPgscPaPdgPrP        
RICH_MOBI_[P]:           dsPeeaPPgPlvPgscPaPdgPrP