A0A1B0GUX0 VAFNB_HUMAN
Gene name: ATP6V1FNB
Protein name: Protein ATP6V1FNB
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P04180 | LCAT | 0.97542 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 2 | P20809 | IL11 | 0.96746 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 3 | Q9Y6U7 | RNF215 | 0.96619 | catabolic process GO:0009056 response to stress GO:0006950 |
| 4 | Q5BKX5 | C19orf54 | 0.92552 | |
| 5 | Q9NPA2 | MMP25 | 0.92505 | anatomical structure development GO:0048856 catabolic process GO:0009056 extracellular matrix organization GO:0030198 ... |
| 6 | P11279 | LAMP1 | 0.90742 | cell death GO:0008219 cytoskeleton-dependent intracellular transport GO:0030705 immune system process GO:0002376 ... |
| 7 | O43516 | WIPF1 | 0.90675 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 cellular component assembly GO:0022607 ... |
| 8 | A0A1B0GUC4 | MYOCOS | 0.9006 | |
| 9 | Q9BTD3 | TMEM121 | 0.89472 | |
| 10 | A0A0U1RRE5 | NBDY | 0.89341 | catabolic process GO:0009056 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MSRQLNIDALRQNFWKEEYLREKMLRCEWYRKYGSMVKAKQKAKAAARLPLKLPTLHPKAPLSPPPAPKSAPSKVPSPVPEAPFQSEMYPVPPITRALLY STMI: DO_DISOPRED3: DD...............................................DD....DDDDDDDDDDDDDDDDDDDDDDDD..................... DO_IUPRED2A: .........................................................DDDDDDDDDDDDDDDDDDDDD...................... DO_SPOTD: DDDDDD...............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............. CONSENSUS: DD...............................................DD....DDDDDDDDDDDDDDDDDDDDDDDD..................... CONSENSUS_MOBI: ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDD.................... RICH_[P]: PkaPlsPPPaPksaPskvPsP RICH_fLPS_[P]: PkaPlsPPPaPksaPskvPsP RICH_MOBI_[P]: PkaPlsPPPaPksaPskvPsPvP RICH_fLPS_MOBI_[P]: PkaPlsPPPaPksaPskvPsPvP
120 140 160 AA: EGISHDFQGRYRYLNTRKLDMPETRYLFPITTSFTYGWQLGPPVKQELVSCKMCRIESFFRKNGAFALLDPRDLAL STMI: DO_DISOPRED3: ..........................................................................DD DO_IUPRED2A: ............................................................................ DO_SPOTD: .......................................................................DDDDD CONSENSUS: ..........................................................................DD CONSENSUS_MOBI: ............................................................................