A0A0U1RRE5 NBDY_HUMAN

Gene name: NBDY
Protein name: Negative regulator of P-body association

List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- nucleobase-containing compound catabolic process GO:0034655

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9UJJ7 RPUSD1 0.91297 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
2 Q9NPA2 MMP25 0.90561 anatomical structure development GO:0048856
catabolic process GO:0009056
extracellular matrix organization GO:0030198
...
3 P19835 CEL 0.89685 anatomical structure development GO:0048856
catabolic process GO:0009056
cell adhesion GO:0007155
...
4 A0A1B0GUX0 ATP6V1FNB 0.89341
5 O43516 WIPF1 0.89272 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
6 Q9Y6U7 RNF215 0.89201 catabolic process GO:0009056
response to stress GO:0006950
7 P20809 IL11 0.88328 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
8 P04180 LCAT 0.87518 biosynthetic process GO:0009058
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
9 A0A1B0GW64 SMIM33 0.87097
10 A6NGB9 WIPF3 0.86835 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...

                                           20                  40                  60            
AA:                      MGDQPCASGRSTLPPGNAREAKPPKKRCLLAPRWDYPEGTPNGGSTTLPSAPPPASAGLKSHPPPPEK
STMI:                                                                                        
DO_DISOPRED3:            DDDDDDDDD........................................DDD.D.DDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[P]:                                                    PegtPnggsttlPsaPPPasaglkshPPPP  
RICH_[GP]:                                                     GtPnGGsttlPsaPPPasaG          
RICH_fLPS_[P]:                                                         tlPsaPPPasaglkshPPPP  
RICH_MOBI_[P]:                                               PegtPnggsttlPsaPPPasaglkshPPPP  
RICH_fLPS_MOBI_[P]:                                                         PPPasaglkshPPPP