P40337 VHL_HUMAN

Gene name: VHL
Protein name: von Hippel-Lindau disease tumor suppressor

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell death GO:0008219
- cell differentiation GO:0030154
- cell morphogenesis GO:0000902
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- response to stress GO:0006950
- signal transduction GO:0007165

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q71U36 TUBA1A 0.95428 cell cycle GO:0007049
cell division GO:0051301
cell junction organization GO:0034330
...
2 A6NIN4 RNF227 0.92042
3 P55822 SH3BGR 0.91648 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
4 Q9UP52 TFR2 0.89604 biosynthetic process GO:0009058
cell-cell signaling GO:0007267
cellular nitrogen compound metabolic process GO:0034641
...
5 Q8TDS7 MRGPRD 0.88629 signal transduction GO:0007165
6 Q9H063 MAF1 0.87674 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
7 O95633 FSTL3 0.87336 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell adhesion GO:0007155
...
8 P51858 HDGF 0.87177 biosynthetic process GO:0009058
cell division GO:0051301
cellular nitrogen compound metabolic process GO:0034641
...
9 Q9BYV2 TRIM54 0.86821 anatomical structure development GO:0048856
catabolic process GO:0009056
cell differentiation GO:0030154
...
10 Q969X0 RILPL2 0.86674 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...

                                           20                  40                  60                  80                 100
AA:                      MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPT
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................DDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................
RICH_[AE]:                   AEnwdEAEvgAEEAgvEE                                                                              
RICH_[E]:                     EnwdEaEvgaEEagvEEygpEEdggEEsgaEEsgpEEsgpEElgaEEEmE                                             
RICH_[EG]:                        EaEvGaEEaGvEEyGpEEdGGEEsGaEEsGpEEsGpEElGaEEE                                               
RICH_fLPS_[E]:                EnwdEaEvgaEEagvEEygpEEdggEEsgaEEsgpEEsgpEElgaEEEmE                                             
RICH_MOBI_[AE]:              AEnwdEAEvgAEEAgvEE                                                                              
RICH_MOBI_[AV]:                    AeVgAeeAgV                                                                                
RICH_MOBI_[E]:                EnwdEaEvgaEEagvEEygpEEdggEEsgaEEsgpEEsgpEE                                                     
RICH_MOBI_[EG]:                   EaEvGaEEaGvEEyGpEEdGGEEsGaEEsGpEEsGpEElG                                                   
RICH_MOBI_[EV]:                     EVgaEEagVEE                                                                              
RICH_fLPS_MOBI_[E]:               EaEvgaEEagvEEygpEEdggEEsgaEEsgpEEsgpEE                                                     

                                          120                 140                 160                 180                 200
AA:                      LPPGTGRRIHSYRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVKPENYRRLDIVRSLYEDLEDHPNVQKDLER
STMI:                                                                                                                        
DO_DISOPRED3:            ....................................................................................................
DO_IUPRED2A:             DDDDDD........................................................................................DD..DD
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ....................................................................................................

                                
AA:                      LTQERIAHQRMGD
STMI:                                 
DO_DISOPRED3:            .....DDDDDDDD
DO_IUPRED2A:             DD..D...D..DD
DO_SPOTD:                ......DDDDDDD
CONSENSUS:               ......DDDDDDD
CONSENSUS_MOBI:          .........DDDD