Q49B96 COX19_HUMAN
Gene name: COX19
Protein name: Cytochrome c oxidase assembly protein COX19
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- homeostatic process GO:0042592
- protein-containing complex assembly GO:0065003
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A2RUQ5 | C17orf102 | 0.69892 | |
| 2 | Q9UK32 | RPS6KA6 | 0.62069 | anatomical structure development GO:0048856 cellular protein modification process GO:0006464 embryo development GO:0009790 ... |
| 3 | Q86XK3 | SFR1 | 0.55445 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 4 | P14091 | CTSE | 0.47287 | |
| 5 | P31350 | RRM2 | 0.47087 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 6 | P48643 | CCT5 | 0.46998 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 chromosome organization GO:0051276 ... |
| 7 | Q9Y592 | CEP83 | 0.43675 | cellular component assembly GO:0022607 transport GO:0006810 vesicle-mediated transport GO:0016192 |
| 8 | Q8WYA1 | ARNTL2 | 0.43595 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | O60783 | MRPS14 | 0.43386 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 10 | P20839 | IMPDH1 | 0.41266 |
20 40 60 80 AA: MSTAMNFGTKSFQPRPPDKGSFPLDHLGECKSFKEKFMKCLHNNNFENALCRKESKEYLECRMERKLMLQEPLEKLGFGDLTSGKSEAKK STMI: DO_DISOPRED3: DDDDDDDDDDDDD.....................................................................DDDDDDDD DO_IUPRED2A: .....DDDDDDDDDDD.DD............................................................D........DD DO_SPOTD: DDDDDDDDDDDDDDDDDDDD................................................DDDDDDDDDDDDDDDDDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDD............................................................DDDDDDDDDDD CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD...................................................................... RICH_MOBI_[FM]: MstaMnFgtksF