A5D6W6 FITM1_HUMAN
Gene name: FITM1
Protein name: Fat storage-inducing transmembrane protein 1
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9NZ38 | IDI2-AS1 | 1 | |
| 2 | Q9UK05 | GDF2 | 0.99967 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 3 | Q9Y3D2 | MSRB2 | 0.99862 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 ... |
| 4 | Q8NHA8 | OR1F12 | 0.9778 | signal transduction GO:0007165 |
| 5 | Q6ZTR6 | ZNF516-DT | 0.90216 | |
| 6 | P04632 | CAPNS1 | 0.88227 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell death GO:0008219 ... |
| 7 | P54652 | HSPA2 | 0.87912 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell differentiation GO:0030154 ... |
| 8 | Q14576 | ELAVL3 | 0.86138 | anatomical structure development GO:0048856 cell differentiation GO:0030154 |
| 9 | Q5UCC4 | EMC10 | 0.85863 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell population proliferation GO:0008283 ... |
| 10 | Q9BUN8 | DERL1 | 0.84119 | biological process involved in symbiotic interaction GO:0044403 catabolic process GO:0009056 cellular protein modification process GO:0006464 ... |
20 40 60 80 100 AA: MERGPVVGAGLGAGARIQALLGCLLKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWLAAVVIFGPLLQFHVNPRTIFASHGNFFNIKFVNSAWGWTC STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDD.DD............................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDD.................................................................................. CONSENSUS: DDDDDDDDDDDDDDDDDD ............... ................... CONSENSUS_MOBI: .................. ............... ................... RICH_[G]: GpvvGaGlGaG RICH_fLPS_[G]: GpvvGaGlGaG
120 140 160 180 200 AA: TFLGGFVLLVVFLATRRVAVTARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTFLLTFCCLLMAEE STMI: MMMMMMMMMMMMMMM MMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ........................................................................ CONSENSUS_MOBI: ........................................................................
220 240 260 280 AA: AAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTVIYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSSRKHN STMI: MMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...............................................................................DDDDDDDDDDDDD DO_IUPRED2A: ............................................................................................ DO_SPOTD: ...............................................................................DDDDDDDDDDDDD CONSENSUS: ............ ........ .........DDDDDDDDDDDDD CONSENSUS_MOBI: ............ ........ ......................