A6NJI1 CK086_HUMAN

Gene name: C11orf86
Protein name: Uncharacterized protein C11orf86

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H410 DSN1 0.7179 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
2 P25021 HRH2 0.70265 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
3 P01286 GHRH 0.69984 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cell-cell signaling GO:0007267
...
4 P11487 FGF3 0.69656 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell division GO:0051301
...
5 Q9NRC6 SPTBN5 0.67605 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell morphogenesis GO:0000902
...
6 Q9BQI9 NRIP2 0.67216
7 A6NI72 NCF1B 0.64528
8 A8MVU1 NCF1C 0.64522
9 Q3SY00 TSGA10IP 0.64136
10 A6NF83 NUPR2 0.63601 biosynthetic process GO:0009058
cell cycle GO:0007049
cell population proliferation GO:0008283
...

                                           20                  40                  60                  80                 100
AA:                      MGTGLRSQSLREPRPSYGKLQEPWGRPQEGQLRRALSLRQGQEKSRSQGLERGTEGPDATAQERVPGSLGDTEQLIQAQRRGSRWWLRRYQQVRRRWESF
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDD................................DDDDDDDDDDDDDDDD........................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..............................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........................
RICH_[QR]:                                   QepwgRpQegQlRRalslRQ                                                            
RICH_[Q]:                                    QepwgrpQegQlrralslrQ                                                            
RICH_[R]:                                         RpqegqlRRalslRqgqeksRsqgleR                                                
RICH_[LQ]:                                             QLrraLsLrQgQeksrsQgL                                                  
RICH_[LR]:                                  LqepwgRpqegqLRRaLsLR                                                             
RICH_MOBI_[QR]:                              QepwgRpQegQlRRalslRQ                                                            
RICH_MOBI_[L]:                              LqepwgrpqegqLrraLsL                                                              
RICH_MOBI_[Q]:                               QepwgrpQegQlrralslrQ                                                            
RICH_MOBI_[R]:                                    RpqegqlRRalslRqgqeksRsqgleR                                                
RICH_MOBI_[LQ]:                                     QegQLrraLsLrQgQeksrsQgL                                                  
RICH_MOBI_[LR]:                             LqepwgRpqegqLRRaLsLR                                                             

                              
AA:                      VAIFPSVTLSQPASP
STMI:                                   
DO_DISOPRED3:            ............DDD
DO_IUPRED2A:             ..........DDDDD
DO_SPOTD:                .......DDDDDDDD
CONSENSUS:               ..........DDDDD
CONSENSUS_MOBI:          ...............