A6NF83 NUPR2_HUMAN

Gene name: NUPR2
Protein name: Nuclear protein 2

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell population proliferation GO:0008283
- cellular nitrogen compound metabolic process GO:0034641
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8IXH6 TP53INP2 0.69091 biosynthetic process GO:0009058
catabolic process GO:0009056
cell differentiation GO:0030154
...
2 A6NI72 NCF1B 0.66225
3 A8MVU1 NCF1C 0.66184
4 P11487 FGF3 0.65192 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell division GO:0051301
...
5 Q96FF7 MISP3 0.64443
6 P59051 BRWD1-AS2 0.6442
7 Q9BTK2 n/a 0.63927
8 Q9BQI9 NRIP2 0.63624
9 A6NJI1 C11orf86 0.63601
10 K9M1U5 IFNL4 0.63513 cellular protein modification process GO:0006464
immune system process GO:0002376
response to stress GO:0006950
...

                                           20                  40                  60                  80   
AA:                      MEAPAERALPRLQALARPPPPISYEEELYDCLDYYYLRDFPACGAGRSKGRTRREQALRTNWPAPGGHERKVAQKLLNGQRKRRQRQLHPKMRTRLT
STMI:                                                                                                                     
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDD.............................DDDDDDDDDDDDDDDDDDD....DDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDD.D.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDD.........................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[QR]:                                                                                    RkvaQkllngQRkRRQRQlhpkmR    
RICH_[AP]:                 APAerAlPrlqAlArPPP                                                                             
RICH_[A]:                  ApAerAlprlqAlA                                                                                 
RICH_[Q]:                                                                                         QkllngQrkrrQrQ          
RICH_[R]:                                                              RskgRtRReqalRtnwpapggheR          RkRRqRqlhpkmRtR  
RICH_fLPS_[R]:                                                                                      llngqRkRRqRqlhpkmRtR  
RICH_MOBI_[QR]:                                                                               RkvaQkllngQRkRRQRQlhpkmR    
RICH_MOBI_[AL]:            ApAerALprLqALA                                                                                 
RICH_MOBI_[AP]:            APAerAlPrlqAlArPPPP                                                                            
RICH_MOBI_[A]:             ApAerAlprlqAlA                                                                                 
RICH_MOBI_[C]:                                         CldyyylrdfpaC                                                      
RICH_MOBI_[RY]:                                           YYYlRdfpacgagRskgRtRR                                           
RICH_MOBI_[L]:                   LprLqaLarppppisyeeeL                                                                     
RICH_MOBI_[P]:              PaeralPrlqalarPPPP                                                                            
RICH_MOBI_[Q]:                                                                                    QkllngQrkrrQrQ          
RICH_MOBI_[R]:                                                RdfpacgagRskgRtRReqalRtnwpapggheR          RkRRqRqlhpkmRtR  
RICH_MOBI_[Y]:                                  YeeelYdcldYYY                                                             
RICH_MOBI_[CD]:                                       DClDyyylrDfpaC                                                      
RICH_MOBI_[CY]:                                 YeeelYdCldYYYlrdfpaC                                                      
RICH_MOBI_[DL]:                                     LyDcLDyyyLrD                                                          
RICH_MOBI_[DY]:                                      YDclDYYYlrD                                                          
RICH_MOBI_[GR]:                                                     GaGRskGRtR                                            
RICH_MOBI_[LP]:                  LPrLqaLarPPPP                                                                            
RICH_MOBI_[LQ]:                                                                                   QkLLngQrkrrQrQL         
RICH_MOBI_[LY]:                                 YeeeLYdcLdYYYL                                                            
RICH_fLPS_MOBI_[Y]:                      rppppisYeeelYdcldYYY