P01286 SLIB_HUMAN

Gene name: GHRH
Protein name: Somatoliberin

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- growth GO:0040007
- signal transduction GO:0007165
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q8NBM4 UBAC2 0.7739 catabolic process GO:0009056
cell-cell signaling GO:0007267
protein transport GO:0015031
...
2 Q16540 MRPL23 0.72608 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
3 A6NJI1 C11orf86 0.69984
4 O95813 CER1 0.68546 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...
5 P14598 NCF1 0.68514 biosynthetic process GO:0009058
cell death GO:0008219
cellular nitrogen compound metabolic process GO:0034641
...
6 O60906 SMPD2 0.65329 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular nitrogen compound metabolic process GO:0034641
...
7 Q9H410 DSN1 0.63311 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...
8 Q3SY00 TSGA10IP 0.63264
9 P61018 RAB4B 0.61073 immune system process GO:0002376
protein transport GO:0015031
signal transduction GO:0007165
...
10 Q8N715 CCDC185 0.59912

                                           20                  40                  60                  80                 100
AA:                      MPLWVFFFVILTLSNSSHCSPPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQ
STMI:                    SSSSSSSSSSSSSSSSSSSS                                                                                
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D.............................D...DDDDDDDDDD..DDDDDDD...............
DO_IUPRED2A:             ....................DD.DD.................................DDDDDDDDDDDDDD............................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDD......................................DDDDDDDDDDDDDDDDDDDDDDD.................D
CONSENSUS:                                   DDDDD..................................DDDDDDDDDDDDDDDDDDDDDDD..................
CONSENSUS_MOBI:                              ...........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........................
RICH_[QR]:                                                                          RQQgesnQeRgaRaRlgRQ                      
RICH_[Q]:                                                                            QQgesnQergararlgrQ                      
RICH_[R]:                                                                           RqqgesnqeRgaRaRlgR                       
RICH_MOBI_[L]:                                                       LgqLsarkLL                                              
RICH_MOBI_[Q]:                                                         QlsarkllQdimsrQQgesnQ                                 
RICH_MOBI_[Y]:                                          YadaiftnsY                                                           
RICH_MOBI_[LQ]:                                                      LgQLsarkLLQdimsrQQ                                      

                                     
AA:                      KHSRNSQG
STMI:                            
DO_DISOPRED3:            DDDDDDDD
DO_IUPRED2A:             ......DD
DO_SPOTD:                DDDDDDDD
CONSENSUS:               DDDDDDDD
CONSENSUS_MOBI:          ........