A6NLC8 YE016_HUMAN

Protein name: Putative TAF11-like protein ENSP00000332601

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A0A1W2PP81 TAF11L7 0.84399 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
2 Q86X53 ERICH1 0.78581
3 A0A1W2PRN6 LINC02218 0.78485 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
4 Q92769 HDAC2 0.77156 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
5 Q8IVU9 CABCOCO1 0.74887
6 P06748 NPM1 0.74311 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
7 Q9H6Y2 WDR55 0.73572 cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
8 Q8N535 LINC00471 0.72621
9 Q8WVC0 LEO1 0.71607 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
10 B5ME19 EIF3CL 0.70858 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80                 100
AA:                      METGRQTGVSAEMFAMPRDLKGSKKDGIPEDLDGNLEEPRDQEGELRSEDVMDLTEGDNEASASAPPAAKRRKTDTKGKKERKPTVDAEEAQRMTTLLSA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD............
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...........
RICH_[AK]:                                                                           AsAsAppAAKrrKtdtKgKK                    
RICH_[D]:                                  DlkgskkDgipeDlD       DqegelrseDvmDltegD                                          
RICH_[E]:                                             EdldgnlEEprdqEgElrsE                                                   
RICH_[K]:                                                                                     KrrKtdtKgKKerK                 
RICH_[DE]:                                        DgipEDlDgnlEEprDqEgE                                                       
RICH_fLPS_[A]:                                                                      eAsAsAppAA                               
RICH_fLPS_[K]:                                                                          sappaaKrrKtdtKgKKerK                 
RICH_MOBI_[AK]:                                                                      AsAsAppAAKrrKtdtKgKK                    
RICH_MOBI_[D]:                             DlkgskkDgipeDlD       DqegelrseDvmDltegD                                          
RICH_MOBI_[E]:                                        EdldgnlEEprdqEgElrsE                                                   
RICH_MOBI_[K]:                                                                                KrrKtdtKgKKerK                 
RICH_MOBI_[DE]:                                   DgipEDlDgnlEEprDqEgE                                                       
RICH_fLPS_MOBI_[A]:                                                                 eAsAsAppAA                               
RICH_fLPS_MOBI_[K]:                                                                     sappaaKrrKtdtKgKKerK                 

                                          120                 140                 160                 180  
AA:                      MSEEQLSRYEVCRRSAFPKACIAGLMRSITGRSVSENVAIAMAGIAKVFVGEVVEEALDVCEMWGEMPPLQPKHLREAVRRLKPKGLFPNSNYKKIMF
STMI:                                                                                                                      
DO_DISOPRED3:            ...........................................................................................DDDDDDD
DO_IUPRED2A:             ..........................................................................DD......................
DO_SPOTD:                .........................................................................................DDDDDDDDD
CONSENSUS:               ...........................................................................................DDDDDDD
CONSENSUS_MOBI:          ..................................................................................................