A0A1W2PRN6 A0A1W2PRN6_HUMAN

Gene name: LINC02218
Protein name: HCG1807616

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- protein-containing complex assembly GO:0065003

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 A0A1W2PP81 TAF11L7 0.93201 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
2 A6NLC8 n/a 0.78485 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
3 P07305 H1-0 0.76396 biosynthetic process GO:0009058
catabolic process GO:0009056
cell death GO:0008219
...
4 Q99880 H2BC13 0.75925 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
5 Q9BY44 EIF2A 0.75039 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
...
6 P33778 H2BC3 0.72959 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
7 Q8N257 H2BU1 0.72565 cellular component assembly GO:0022607
chromosome organization GO:0051276
protein-containing complex assembly GO:0065003
8 Q99877 H2BC15 0.71595 cellular component assembly GO:0022607
cellular protein modification process GO:0006464
chromosome organization GO:0051276
...
9 Q8N6R0 EEF1AKNMT 0.71425
10 P62424 RPL7A 0.7119 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...

                                           20                  40                  60                  80                 100
AA:                      METGRQAGVSAEMFAMPRGLKGSNKDGIPEDLDGNLEEPRDQEGELRSQDVMDLTEGDKETSASAPPAAKRLKTDTKGKKERKPTVDAEEAQRMTTLLSA
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..........
RICH_[AK]:                                                                         KetsAsAppAAKrlKtdtKgKK                    
RICH_[AM]:                     AgvsAeMfAM                                                                                    
RICH_[D]:                                         DgipeDlDgnleeprD                                                           
RICH_[K]:                                                                          KetsasappaaKrlKtdtKgKKerK                 
RICH_[DE]:                                        DgipEDlDgnlEEprDqEgE                                                       
RICH_fLPS_[K]:                                                                          sappaaKrlKtdtKgKKerK                 
RICH_MOBI_[AK]:                                                                    KetsAsAppAAKrlKtdtKgKK                    
RICH_MOBI_[AM]:                AgvsAeMfAM                                                                                    
RICH_MOBI_[D]:                                    DgipeDlDgnleeprD                                                           
RICH_MOBI_[K]:                                                                     KetsasappaaKrlKtdtKgKKerK                 
RICH_MOBI_[DE]:                                   DgipEDlDgnlEEprDqEgE                                                       
RICH_MOBI_[GM]:             GrqaGvsaeMfaMprGlkG                                                                              
RICH_fLPS_MOBI_[K]:                                                                     sappaaKrlKtdtKgKKerK                 

                                          120                 140                 160                 180  
AA:                      MSEEQLARYEVCRQSAFPKARIAALMQSITGSSVSENVAIAMAGIAKVLVGEVVEEALDVCEMWGEMPPLQPKHLREAVRRLKPKGLFPNSNYKKFMF
STMI:                                                                                                                      
DO_DISOPRED3:            ...........................................................................................DDDDDDD
DO_IUPRED2A:             ..........................................................................DD......................
DO_SPOTD:                ........................................................................................DDDDDDDDDD
CONSENSUS:               ...........................................................................................DDDDDDD
CONSENSUS_MOBI:          ..................................................................................................