A6NLX4 TM210_HUMAN

Gene name: TMEM210
Protein name: Transmembrane protein 210

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P42680 TEC 0.9538 anatomical structure development GO:0048856
cellular protein modification process GO:0006464
growth GO:0040007
...
2 P58335 ANTXR2 0.93591 reproduction GO:0000003
transport GO:0006810
3 O14556 GAPDHS 0.93363 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
...
4 P31948 STIP1 0.89641
5 A0A1B0GUX0 ATP6V1FNB 0.86655
6 Q8N967 LRTM2 0.86139 anatomical structure development GO:0048856
cell differentiation GO:0030154
cell junction organization GO:0034330
...
7 P04180 LCAT 0.84408 biosynthetic process GO:0009058
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
8 Q9NZN9 AIPL1 0.84337 cell death GO:0008219
cellular protein modification process GO:0006464
homeostatic process GO:0042592
...
9 P20809 IL11 0.83983 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell differentiation GO:0030154
...
10 Q9Y6U7 RNF215 0.83798 catabolic process GO:0009056
response to stress GO:0006950

                                           20                  40                  60                  80                 100
AA:                      MAPGPWPVSCLRGGPLGLTYLSLLLIPAAAGTYCECSLGLSREALIALLVVLAGISASCFCALVIVAIGVLRAKGETCPRQVDNRLVENFGVQEDLMDLH
STMI:                    SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS                MMMMMMMMMMMMMMMMMMMMM                                
DO_DISOPRED3:            DDDD................................................................................................
DO_IUPRED2A:             ....................................................................................................
DO_SPOTD:                DDDDD........................................................................................DDDDDD.
CONSENSUS:                                              ................                     ................................
CONSENSUS_MOBI:                                         ................                     ................................

                                          120                 140             
AA:                      PVYVESQLMDADLEVSLVPPLEDQSLVAIPMEASSEEPPPPPPLPPE
STMI:                                                                   
DO_DISOPRED3:            .................................DDDDDDDDDDDDDD
DO_IUPRED2A:             ............................DDDDDDDDDDDDDDDDDDD
DO_SPOTD:                .......DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               ............................DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ...........................DDDDDDDDDDDDDDDDDDDD
RICH_[P]:                                             PmeasseePPPPPPlPP 
RICH_[EP]:                                              EassEEPPPP      
RICH_fLPS_[P]:                                        PmeasseePPPPPPlPP 
RICH_MOBI_[P]:                                        PmeasseePPPPPPlPP 
RICH_MOBI_[EP]:                                       PmEassEEPPPPPPlPPE
RICH_fLPS_MOBI_[P]:                                 aiPmeasseePPPPPPlPPe