P20809 IL11_HUMAN
Gene name: IL11
Protein name: Interleukin-11
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell differentiation GO:0030154
- cell population proliferation GO:0008283
- cell-cell signaling GO:0007267
- cellular nitrogen compound metabolic process GO:0034641
- cellular protein modification process GO:0006464
- immune system process GO:0002376
- signal transduction GO:0007165
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y6U7 | RNF215 | 0.9961 | catabolic process GO:0009056 response to stress GO:0006950 |
| 2 | A0A1B0GUX0 | ATP6V1FNB | 0.96746 | |
| 3 | P23396 | RPS3 | 0.96461 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 4 | A0A1B0GUC4 | MYOCOS | 0.92894 | |
| 5 | Q9NPA2 | MMP25 | 0.91043 | anatomical structure development GO:0048856 catabolic process GO:0009056 extracellular matrix organization GO:0030198 ... |
| 6 | Q9Y6J3 | SMAD5-AS1 | 0.90833 | signal transduction GO:0007165 |
| 7 | P04180 | LCAT | 0.90463 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 8 | Q5BKX5 | C19orf54 | 0.90283 | |
| 9 | O43516 | WIPF1 | 0.89987 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 cellular component assembly GO:0022607 ... |
| 10 | Q7Z7M8 | B3GNT8 | 0.88868 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cellular protein modification process GO:0006464 |
20 40 60 80 100 AA: MNCVCRLVLVVLSLWPDTAVAPGPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRAD STMI: SSSSSSSSSSSSSSSSSSSSS DO_DISOPRED3: DD.....D..D.DDDDD..DDDDDD.D......................................................................... DO_IUPRED2A: ...................DDDDDDDDDDDDDDDDDDD......................DDDD..D...DD............................ DO_SPOTD: ................DDDDDDDDDDDDDDDDDD.................................................................. CONSENSUS: DDDDDDDDDDDDD.................................................................. CONSENSUS_MOBI: .DDDDDDDDDDD................................................DD................. RICH_[P]: PgPPPgPPrvsP RICH_MOBI_[P]: PPPgPPrvsP RICH_fLPS_MOBI_[P]: PPPgPPrvsP
120 140 160 180 AA: LLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL STMI: DO_DISOPRED3: ................................................DDDDDDDDDDDD......................................D DO_IUPRED2A: .....................D.........................DDDDDDDDDDDDDDDDDDD................................. DO_SPOTD: .............................................DDDDDDDDDDDDDDD....................................... CONSENSUS: ...............................................DDDDDDDDDDDDD....................................... CONSENSUS_MOBI: ...................................................DDD............................................. RICH_[P]: PqPPPdPPaPP RICH_fLPS_[P]: PqPPPdPPaPP