A6NM45 CLD24_HUMAN
Gene name: CLDN24
Protein name: Putative claudin-24
List of terms from Generic GO subset, which this protein is a part of:
- cell adhesion GO:0007155
- cell junction organization GO:0034330
- cellular component assembly GO:0022607
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y5T4 | DNAJC15 | 0.67428 | cellular component assembly GO:0022607 generation of precursor metabolites and energy GO:0006091 protein targeting GO:0006605 ... |
| 2 | Q8TAC9 | SCAMP5 | 0.61161 | cell-cell signaling GO:0007267 protein transport GO:0015031 response to stress GO:0006950 ... |
| 3 | Q9H1L0 | MIR1-1HG | 0.60331 | |
| 4 | Q96G30 | MRAP2 | 0.60331 | generation of precursor metabolites and energy GO:0006091 homeostatic process GO:0042592 signal transduction GO:0007165 |
| 5 | Q15436 | SEC23A | 0.56643 | cellular component assembly GO:0022607 immune system process GO:0002376 membrane organization GO:0061024 ... |
| 6 | Q9NRD0 | FBXO8 | 0.53498 | catabolic process GO:0009056 signal transduction GO:0007165 |
| 7 | Q14592 | ZNF460 | 0.52097 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 8 | Q99062 | CSF3R | 0.50198 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
| 9 | Q96PK6 | RBM14 | 0.49098 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 10 | Q9GZQ4 | NMUR2 | 0.4803 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 homeostatic process GO:0042592 ... |
20 40 60 80 100 AA: MALIFRTAMQSVGLLLSLLGWILSIITTYLPHWKNLNLDLNEMENWTMGLWQTCVIQEEVGMQCKDFDSFLALPAELRVSRILMFLSNGLGFLGLLVSGF STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDD.D............................................................................................ DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDD.............................................................................................. CONSENSUS: DDDDDD.... .................................................. CONSENSUS_MOBI: .......... ..................................................
120 140 160 180 200 AA: GLDCLRIGESQRDLKRRLLILGGILSWASGITALVPVSWVAHKTVQEFWDENVPDFVPRWEFGEALFLGWFAGLSLLLGGCLLNCAACSSHAPLALGHYA STMI: MM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: ...........................................................................................DDDDDDDDD DO_IUPRED2A: .................................................................................................... DO_SPOTD: ..........................................................................................DDDDDDDDDD CONSENSUS: ............... ....................... .........DDDDDDDDD CONSENSUS_MOBI: ............... ....................... .................. RICH_[QY]: Ya RICH_[AY]: AplAlghYA