Q9Y5T4 DJC15_HUMAN
Gene name: DNAJC15
Protein name: DnaJ homolog subfamily C member 15
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- generation of precursor metabolites and energy GO:0006091
- protein targeting GO:0006605
- protein transport GO:0015031
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P46094 | XCR1 | 0.70711 | homeostatic process GO:0042592 immune system process GO:0002376 response to stress GO:0006950 ... |
| 2 | A6NM45 | CLDN24 | 0.67428 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 |
| 3 | O14493 | CLDN4 | 0.65211 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 4 | Q9Y5I7 | CLDN16 | 0.6132 | cell adhesion GO:0007155 cell junction organization GO:0034330 cellular component assembly GO:0022607 ... |
| 5 | Q9BQ04 | RBM4B | 0.59223 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 mRNA processing GO:0006397 ... |
| 6 | Q96PK6 | RBM14 | 0.5613 | biosynthetic process GO:0009058 cell cycle GO:0007049 cellular component assembly GO:0022607 ... |
| 7 | Q5MNZ9 | WIPI1 | 0.54241 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
| 8 | Q8TEW6 | DOK4 | 0.54137 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cell morphogenesis GO:0000902 |
| 9 | Q9UIB8 | CD84 | 0.52796 | catabolic process GO:0009056 cell adhesion GO:0007155 immune system process GO:0002376 ... |
| 10 | Q9Y4P8 | WIPI2 | 0.49296 | biosynthetic process GO:0009058 catabolic process GO:0009056 cellular component assembly GO:0022607 ... |
20 40 60 80 100 AA: MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITETAKKISTPSFSSYYKGGFEQKMSRREAGLI STMI: MMMMMMMMMMMMMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDD.DDDD..........................................DDDD.DD.DD................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.........................................DDDDDDDD.D................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDD...... .............DDDDDDDDDD................... CONSENSUS_MOBI: ................................... .......................................... RICH_[AY]: AArgviApvgeslrYAeY
120 140 AA: LGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEAKDLLETTTKH STMI: DO_DISOPRED3: ..............................................DDDD DO_IUPRED2A: ....................D..........................DD. DO_SPOTD: ............................................DDDDDD CONSENSUS: ..............................................DDDD CONSENSUS_MOBI: ..................................................