List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q9H147	DNTTIP1	0.75695
2	Q5VV11	n/a	0.743
3	Q9NRC8	SIRT7	0.6903	biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 cell cycle GO:0007049 ...
4	Q9NRA2	SLC17A5	0.68992	transport GO:0006810
5	Q6QEF8	CORO6	0.6869	cytoskeleton organization GO:0007010
6	Q5XG85	n/a	0.6828
7	Q96NB1	CEP20	0.67384	cellular component assembly GO:0022607 cytoskeleton organization GO:0007010
8	Q8TAU3	ZNF417	0.67347	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
9	Q96SQ5	ZNF587	0.67237	biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641
10	Q8IYR6	TMEFF1	0.66167	anatomical structure development GO:0048856 cell differentiation GO:0030154 cell junction organization GO:0034330 ...

                                           20                  40                  60                  80      
AA:                      MRKLRLRASNPGPSGAPGTRRHFSTSGGGHHCGRRWLRRVRRSRSQTPSCQNLDPNPPIARFPLPLERISEVPRRACLHGRDASSVWPPPERSD
STMI:                                                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDD.......................................................................DDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......DDDD..DDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDD.DDDDD..............DDDDDDD.DD.DDD...................DDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDD..............DDDDDDDDDDDDDD...................DDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.............................................................
RICH_[R]:                 RklRlRasnpgpsgapgtRR                                                                         
RICH_MOBI_[G]:                      GpsGapGtrrhfstsGGG                                                                 
RICH_MOBI_[H]:                                HfstsgggHH                                                               
RICH_MOBI_[R]:            RklRlRasnpgpsgapgtRR                                                                         
RICH_MOBI_[GH]:                               HfstsGGGHHcG