Q6UXZ3 CLM5_HUMAN

Gene name: CD300LD
Protein name: CMRF35-like molecule 5

List of terms from Generic GO subset, which this protein is a part of:
- immune system process GO:0002376

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O43586 PSTPIP1 0.87579 cell adhesion GO:0007155
immune system process GO:0002376
response to stress GO:0006950
...
2 O95319 CELF2 0.75483 cellular component assembly GO:0022607
cellular nitrogen compound metabolic process GO:0034641
circulatory system process GO:0003013
...
3 Q9H3Z4 DNAJC5 0.74417 cell death GO:0008219
cell-cell signaling GO:0007267
immune system process GO:0002376
...
4 Q9NXI6 RNF186 0.74143 catabolic process GO:0009056
cell death GO:0008219
cellular protein modification process GO:0006464
...
5 A6NNB3 IFITM5 0.74072 anatomical structure development GO:0048856
embryo development GO:0009790
6 Q9NZN1 IL1RAPL1 0.73448 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
7 Q9NZU1 FLRT1 0.73091 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...
8 O00116 AGPS 0.72841 biosynthetic process GO:0009058
protein targeting GO:0006605
protein transport GO:0015031
...
9 P39086 GRIK1 0.71514 anatomical structure development GO:0048856
cell-cell signaling GO:0007267
signal transduction GO:0007165
10 Q96IY1 NSL1 0.70483 cell cycle GO:0007049
cell division GO:0051301
chromosome organization GO:0051276
...

                                           20                  40                  60                  80                 100
AA:                      MWLSPSLLLLILPGYSIAAKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRD
STMI:                    SSSSSSSSSSSSSSSSSS                                                                                  
DO_DISOPRED3:            DDDDDDDDDDDD........................................................................................
DO_IUPRED2A:             ..........................................................................DDDDD.....................
DO_SPOTD:                ....................................................................................................
CONSENSUS:                                 ..................................................................................
CONSENSUS_MOBI:                            ..................................................................................

                                          120                 140                 160                 180      
AA:                      DADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTHFLFLFLLELPLLLSMLGTVLWVNRPQRRS
STMI:                                                                                     MMMMMMMMMMMMMMMMMMMMM        
DO_DISOPRED3:            .............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..D.D...DD
DO_IUPRED2A:             ......................................................D.......................................
DO_SPOTD:                ............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               .............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD                     DDD...DD
CONSENSUS_MOBI:          .................................................................                     ........
RICH_[AT]:                                            TAvsewTTTTAslAfTAAATqkTssplT                                     
RICH_[A]:                                              AvsewttttAslAftAAA                                              
RICH_[T]:                                             TavsewTTTTaslafTaaaTqkTssplTrsplksT                              
RICH_fLPS_[A]:                                                 tAslAftAAA                                              
RICH_fLPS_[T]:                                        TavsewTTTTaslafTaaaTqkTssplT                                     
RICH_fLPS_[TA]:                                       TAvsewTTTTAslAfTAAAT