Q86U28 ISCA2_HUMAN
Gene name: ISCA2
Protein name: Iron-sulfur cluster assembly 2 homolog, mitochondrial
List of terms from Generic GO subset, which this protein is a part of:
- cellular component assembly GO:0022607
- protein maturation GO:0051604
- small molecule metabolic process GO:0044281
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6NNB3 | IFITM5 | 0.86729 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 2 | P61964 | WDR5 | 0.77729 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 3 | Q9UNW8 | GPR132 | 0.73979 | cell cycle GO:0007049 mitotic cell cycle GO:0000278 signal transduction GO:0007165 |
| 4 | O43586 | PSTPIP1 | 0.70972 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 ... |
| 5 | P61647 | ST8SIA6 | 0.6946 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 6 | Q9NZN1 | IL1RAPL1 | 0.68316 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 7 | O94941 | UBOX5 | 0.6708 | cellular protein modification process GO:0006464 |
| 8 | O95319 | CELF2 | 0.65119 | cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 circulatory system process GO:0003013 ... |
| 9 | Q9NZU1 | FLRT1 | 0.64143 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 10 | Q6UXZ3 | CD300LD | 0.64049 | immune system process GO:0002376 |
20 40 60 80 100 AA: MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFE STMI: TTTTTTTT DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....................................................... DO_IUPRED2A: ...........................D..D.DDDDDDDDDDDDDD..D................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..................................................... CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD...................................................... CONSENSUS_MOBI: ....................DDDDDDDDDDDDDDDDDDDDD................................................... RICH_[AT]: TAATqrAvTpwprgrllTA RICH_[R]: RgRlltaslgpqaRR RICH_[T]: TaaTqravTpwprgrllT
120 140 AA: QGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKL STMI: DO_DISOPRED3: ...................................................... DO_IUPRED2A: ...................................................... DO_SPOTD: ....................................................D. CONSENSUS: ...................................................... CONSENSUS_MOBI: ......................................................