A8K830 COLC2_HUMAN
Gene name: COLCA2
Protein name: Colorectal cancer-associated protein 2
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9H7T0 | CATSPERB | 1 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 2 | A8K830 | COLCA2 | 1 | |
| 3 | P41586 | ADCYAP1R1 | 0.94868 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 4 | P52741 | ZNF134 | 0.86155 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 5 | Q6PJE2 | POMZP3 | 0.8351 | anatomical structure development GO:0048856 cell differentiation GO:0030154 reproduction GO:0000003 |
| 6 | P23109 | AMPD1 | 0.81402 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 7 | Q6P5X7 | TMEM71 | 0.79243 | |
| 8 | Q8N699 | MYCT1 | 0.73427 | |
| 9 | Q04656 | ATP7A | 0.71646 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | P0CF97 | FAM200B | 0.71045 |
20 40 60 80 100 AA: MHPEPLLNSTQSAPHHFPDSFQATPFCFNQSLIPGSPSNSSILSGSLDYSYSPVQLPSYAPENYNSPASLDTRTCGYPPEDHSYQHLSSHAQYSCFSSAT STMI: DO_DISOPRED3: DDDDDD.DD.....................DDDDDDDDDDDDDDD.....................D................................. DO_IUPRED2A: DDDDDDDDDD.DD.........................................................D............................. DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................... CONSENSUS: DDDDDDDDDDDDD.................DDDDDDDDDDDDDDD.....................DDDDD............................. CONSENSUS_MOBI: .................................................................................................... RICH_[S]: SlipgSpSnSSilS RICH_[IS]: SlIpgSpSnSSIlS
120 140 AA: TSICYCASCEAEDLDALQAAEYFYPSTDCVDFAPSAAATSDFYKRETNCDICYS STMI: DO_DISOPRED3: ...................................................... DO_IUPRED2A: ...................................................... DO_SPOTD: ...................................................... CONSENSUS: ...................................................... CONSENSUS_MOBI: ......................................................