A8MUL3 ADAS1_HUMAN
Gene name: ADARB2-AS1
Protein name: Putative uncharacterized protein ADARB2-AS1
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6NNB3 | IFITM5 | 0.70711 | anatomical structure development GO:0048856 embryo development GO:0009790 |
| 2 | O95755 | RAB36 | 0.6595 | protein transport GO:0015031 signal transduction GO:0007165 transport GO:0006810 |
| 3 | P61964 | WDR5 | 0.63372 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 4 | Q86U28 | ISCA2 | 0.62984 | cellular component assembly GO:0022607 protein maturation GO:0051604 small molecule metabolic process GO:0044281 |
| 5 | P61647 | ST8SIA6 | 0.59867 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 6 | Q9NZN1 | IL1RAPL1 | 0.59656 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 7 | Q9NZU1 | FLRT1 | 0.59537 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 8 | P55058 | PLTP | 0.59136 | biosynthetic process GO:0009058 reproduction GO:0000003 small molecule metabolic process GO:0044281 ... |
| 9 | A8K4G0 | CD300LB | 0.57735 | immune system process GO:0002376 response to stress GO:0006950 |
| 10 | O00116 | AGPS | 0.54453 | biosynthetic process GO:0009058 protein targeting GO:0006605 protein transport GO:0015031 ... |
20 40 60 80 100 AA: MKQLFPPPPGTSLTHALGAWRGRERAQAATSLLASSASQFPTAVEDALMSVLTSHCAPSTPAATRAQQTGTRGHIHPACPCQQSCVGASRPPGRPQIFLP STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDD.........DD............................DDDDDDDDDD..DD.......................... DO_SPOTD: DDDD.....................................................DDDDDDDDDDDDDDDD........................... CONSENSUS: DDDD........................................................DDDDDDDDDDDDD........................... CONSENSUS_MOBI: .................................................................................................... RICH_[AT]: AATrAqqTgT
120 140 AA: LTTALSLEAYAADTCSAADFLHNPSSWGKVWYLNEASFDLYSYHYFW STMI: DO_DISOPRED3: ............................................... DO_IUPRED2A: ............................................... DO_SPOTD: ............................................... CONSENSUS: ............................................... CONSENSUS_MOBI: ...............................................