B7Z368 CJ142_HUMAN

Gene name: LINC02881
Protein name: Uncharacterized protein encoded by LINC02881

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9H606 PRORY 0.79943
2 Q9HD15 SRA1 0.74653 anatomical structure development GO:0048856
cell cycle GO:0007049
cell death GO:0008219
...
3 Q2PZI1 DPY19L1 0.73705 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
4 Q96L33 RHOV 0.72803 anatomical structure development GO:0048856
cell morphogenesis GO:0000902
cellular component assembly GO:0022607
...
5 P51512 MMP16 0.72253 anatomical structure development GO:0048856
catabolic process GO:0009056
cell population proliferation GO:0008283
...
6 Q96MX3 ZNF48 0.72132
7 Q9NYG8 KCNK4 0.70315 nervous system process GO:0050877
transmembrane transport GO:0055085
transport GO:0006810
8 Q8N7Y1 KIRREL3-AS3 0.70162
9 P48634 PRRC2A 0.69451 cell differentiation GO:0030154
10 O75161 NPHP4 0.6911 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...

                                           20                  40                  60                  80                 100
AA:                      MRMYSSDAHERPPSPSLGTTPPHPLPPTGSPRPRQDSAAGNSEEREPRGLRRASGVGSSCKRPTVCMGRQQGLPFCTVCGYRCSSPERTRGRCAVGKVRV
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDD.DD.DDD....DDDDDDDDDDDDDD......................................................
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................DDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................DDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
RICH_[PT]:                                 TTPPhPlPPT                                                                        
RICH_[G]:                                                                                                               Gkvrv
RICH_[P]:                           PPsPslgttPPhPlPPtgsPrP                                                                   
RICH_[R]:                                               RpRqdsaagnseeRepRglRR                                                
RICH_[ER]:                                                         EEREpRglRR                                                
RICH_[GV]:                                                                                                             VGkVrV
RICH_[HP]:                       HerPPsPslgttPPH                                                                             
RICH_fLPS_[P]:                      PPsPslgttPPhPlPPtgsPrP                                                                   
RICH_MOBI_[PT]:                            TTPPhPlPPT                                                                        
RICH_MOBI_[P]:                      PPsPslgttPPhPlPPtgsPrP                                                                   
RICH_MOBI_[R]:                                          RpRqdsaagnseeRepRglRRasgvgssckR                                      
RICH_MOBI_[GR]:                                                 GnseeRepRGlRRasGvG                                           
RICH_fLPS_MOBI_[P]:                 PPsPslgttPPhPlPPtgsP                                                                     

                                          120          
AA:                      AGGGGAPGGGAGMRCCGCRERNINKELELF
STMI:                                                  
DO_DISOPRED3:            ..............................
DO_IUPRED2A:             DDDDD.........................
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDD.........................
CONSENSUS_MOBI:          ..............................
RICH_[G]:                aGGGG                         
RICH_[GV]:               aGGG