Q9H606 PRORY_HUMAN
Gene name: PRORY
Protein name: Proline-rich protein, Y-linked
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | P51512 | MMP16 | 0.80725 | anatomical structure development GO:0048856 catabolic process GO:0009056 cell population proliferation GO:0008283 ... |
| 2 | Q9HD15 | SRA1 | 0.79963 | anatomical structure development GO:0048856 cell cycle GO:0007049 cell death GO:0008219 ... |
| 3 | B7Z368 | LINC02881 | 0.79943 | |
| 4 | Q2PZI1 | DPY19L1 | 0.79846 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 5 | Q96L33 | RHOV | 0.77919 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 cellular component assembly GO:0022607 ... |
| 6 | A0A1B0GUX0 | ATP6V1FNB | 0.75477 | |
| 7 | O43516 | WIPF1 | 0.74496 | anatomical structure development GO:0048856 cell morphogenesis GO:0000902 cellular component assembly GO:0022607 ... |
| 8 | P04180 | LCAT | 0.73721 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 homeostatic process GO:0042592 ... |
| 9 | Q96SQ7 | ATOH8 | 0.72999 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 10 | P20809 | IL11 | 0.72989 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
20 40 60 80 100 AA: MMRRSPSGLKSPRVSQGRKPRDPESLLFLRCCLGSEPHNLSSLLSPEAGQEPLPKLLPQPLAGHAAWGIHGVPTSLLLAGECWGQGMAVPADPPPASPYR STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDDDDDDDD....................DDDDDDDDDDDDDDDDD.............................DDDDDDDDDDDDD DO_SPOTD: DDDDDDDDDDDDDDDDDDDDD........................................................................DDDDDDD CONSENSUS: DDDDDDDDDDDDDDDDDDDDD........................................................................DDDDDDD CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDD..................................................................DDDDDDDDDDDD RICH_[P]: PPasPyr RICH_[R]: RRspsglkspRvsqgRkpR RICH_fLPS_[P]: PPasPyr RICH_MOBI_[P]: PadPPPasPyr RICH_MOBI_[R]: RRspsglkspRvsqgRkpR RICH_MOBI_[MR]: MMRRspsglkspRvsqgR RICH_fLPS_MOBI_[P]: vPadPPPasPyr
120 140 160 180 AA: TSPRPPPGPLPRYRPQQHLLLPLGRLHALCPGCPLQQSLQFERGTLSAPRLWSWMKLETIILSKLSQGQKTKHRMFSLISES STMI: DO_DISOPRED3: .................................................................................. DO_IUPRED2A: DDDDDDDDDDDDDDD............................................................DD..... DO_SPOTD: DDDDDDDDDDDD...................................................................DDD CONSENSUS: DDDDDDDDDDDD...................................................................... CONSENSUS_MOBI: DDDDDDDD.......................................................................... RICH_[P]: tsPrPPPgPlP RICH_fLPS_[P]: tsPrPPPgPlP RICH_MOBI_[P]: tsPrPPP RICH_fLPS_MOBI_[P]: tsPrPPPg