B7Z3J9 B7Z3J9_HUMAN

Gene name: LOC730098
Protein name: HCG2040265, isoform CRA_a

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P10253 GAA 0.75161 anatomical structure development GO:0048856
carbohydrate metabolic process GO:0005975
catabolic process GO:0009056
...
2 A0A0U1RQF7 DPEP2NB 0.70194
3 Q9HC57 WFDC1 0.67343 cell population proliferation GO:0008283
growth GO:0040007
response to stress GO:0006950
4 Q8IUH2 CREG2 0.65607
5 Q04844 CHRNE 0.64396 cell-cell signaling GO:0007267
nervous system process GO:0050877
signal transduction GO:0007165
...
6 Q5BJH7 YIF1B 0.63718 protein targeting GO:0006605
protein transport GO:0015031
transport GO:0006810
...
7 Q9Y697 NFS1 0.63073 biosynthetic process GO:0009058
cellular component assembly GO:0022607
cellular protein modification process GO:0006464
...
8 P06307 CCK 0.62228 anatomical structure development GO:0048856
cell death GO:0008219
cell differentiation GO:0030154
...
9 Q9NV39 PRR34 0.61913
10 Q9UNP4 ST3GAL5 0.60591 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
cellular nitrogen compound metabolic process GO:0034641
...

                                           20                  40                  60                  80             
AA:                      MSGMRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSSAHPGEQKLEPLRGLMSCLSSGLGPTPQRSGRGFPRRSPTAAAQPASALKI
STMI:                                                                                                           
DO_DISOPRED3:            DDD..............................................................DDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             ......................................DD.DD...............D...DDDDDDDDDDDDDD....D......
DO_SPOTD:                DDDDDD............................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDD...................................DDDDD...............DDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          ......................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[PR]:                                                                           PtPqRsgRgfPRRsPtaaaqP      
RICH_[AP]:                                                                             PqrsgrgfPrrsPtAAAqPA     
RICH_[AR]:                                                                               RsgRgfpRRsptAAAqpAsA   
RICH_fLPS_[A]:                                                                                     ptAAAqpAsA   
RICH_MOBI_[AR]:                                                                          RsgRgfpRRsptAAAqpAsA   
RICH_MOBI_[GR]:                                                                   GlGptpqRsGRGfpRR              
RICH_fLPS_MOBI_[A]:                                                                                ptAAAqpAsA