B9EJG8 T150C_HUMAN
Gene name: TMEM150C
Protein name: Transmembrane protein 150C
List of terms from Generic GO subset, which this protein is a part of:
- catabolic process GO:0009056
- nervous system process GO:0050877
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q02363 | ID2 | 0.90348 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 2 | Q8TAG5 | VSTM2A | 0.90286 | cell differentiation GO:0030154 cell population proliferation GO:0008283 |
| 3 | P15907 | ST6GAL1 | 0.90016 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 cellular protein modification process GO:0006464 ... |
| 4 | Q16445 | GABRA6 | 0.89443 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 5 | P41586 | ADCYAP1R1 | 0.89443 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 ... |
| 6 | Q9NPH3 | IL1RAP | 0.89004 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell adhesion GO:0007155 ... |
| 7 | Q7Z7C7 | STRA8 | 0.88822 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 8 | P59773 | MINAR2 | 0.87416 | |
| 9 | P28336 | NMBR | 0.87179 | signal transduction GO:0007165 |
| 10 | Q9ULD0 | OGDHL | 0.86824 | carbohydrate metabolic process GO:0005975 catabolic process GO:0009056 cellular nitrogen compound metabolic process GO:0034641 ... |
20 40 60 80 100 AA: MDGKKCSVWMFLPLVFTLFTSAGLWIVYFIAVEDDKILPLNSAERKPGVKHAPYISIAGDDPPASCVFSQVMNMAAFLALVVAVLRFIQLKPKVLNPWLN STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMM DO_DISOPRED3: DDDDDD.DDDDDDDDDDDDDDD.............................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDD.....DDDDDD.D.................................................................................. CONSENSUS: DDDDD.... .................................. ............ CONSENSUS_MOBI: ......... .................................. ............
120 140 160 180 200 AA: ISGLVALCLASFGMTLLGNFQLTNDEEIHNVGTSLTFGFGTLTCWIQAALTLKVNIKNEGRRVGIPRVILSASITLCVVLYFILMAQSIHMYAARVQWGL STMI: MMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ............ ................. ... CONSENSUS_MOBI: ............ ................. ...
220 240 AA: VMCFLSYFGTFAVEFRHYRYEIVCSEYQENFLSFSESLSEASEYQTDQV STMI: MMMMMMMMMMMMM DO_DISOPRED3: .............................DDDDDDDDDDDDDDDDDDDD DO_IUPRED2A: ................................................. DO_SPOTD: ............................DDDDDDDDDDDDDDDDDDDDD CONSENSUS: ................DDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: .................................... RICH_[S]: SfSeSlSeaS