G3V4N2 G3V4N2_HUMAN

Gene name: hCG_2042738
Protein name: HCG2042738, isoform CRA_a

List of terms from Generic GO subset, which this protein is a part of:

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q96GM1 PLPPR2 0.49067 signal transduction GO:0007165
2 Q8TAD8 SNIP1 0.44708 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...
3 Q4AC99 ACCSL 0.43329 biosynthetic process GO:0009058
4 Q8N7L0 FAM216B 0.43293
5 Q96BI3 APH1A 0.41942
6 Q9Y2T4 PPP2R2C 0.41709 cellular protein modification process GO:0006464
7 O75449 KATNA1 0.41622 cell cycle GO:0007049
cell division GO:0051301
cytoskeleton organization GO:0007010
8 Q9H6H4 REEP4 0.41217 cell cycle GO:0007049
cell division GO:0051301
membrane organization GO:0061024
...
9 Q8WYQ4 C22orf15 0.40832
10 P56706 WNT7B 0.40592 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell differentiation GO:0030154
...

                                           20   
AA:                      MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQE
STMI:                                                         
DO_DISOPRED3:            D..................................DD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[RV]:                         RRtteqhVpeVeVqVkRRR        
RICH_[R]:                  RaRdRlhlRR                         
RICH_[HR]:                 RaRdRlHlRRtteqH                    
RICH_[HV]:                       HlrrtteqHVpeVeV              
RICH_fLPS_[V]:                          qhVpeVeVqV            
RICH_MOBI_[RV]:                    RRtteqhVpeVeVqVkRRR        
RICH_MOBI_[R]:             RaRdRlhlRR                         
RICH_MOBI_[HR]:            RaRdRlHlRRtteqH                    
RICH_MOBI_[HV]:                  HlrrtteqHVpeVeV              
RICH_fLPS_MOBI_[V]:                     qhVpeVeVqV