Q7Z3Z2 RD3_HUMAN

Gene name: RD3
Protein name: Protein RD3

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cellular nitrogen compound metabolic process GO:0034641
- nervous system process GO:0050877
- protein transport GO:0015031
- small molecule metabolic process GO:0044281
- transport GO:0006810

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q13393 PLD1 0.83197 biosynthetic process GO:0009058
catabolic process GO:0009056
cellular component assembly GO:0022607
...
2 P41181 AQP2 0.82624 anatomical structure development GO:0048856
cellular component assembly GO:0022607
homeostatic process GO:0042592
...
3 O00168 FXYD1 0.808 cellular protein modification process GO:0006464
circulatory system process GO:0003013
transmembrane transport GO:0055085
...
4 P17017 ZNF14 0.80247 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
5 Q9UBV4 WNT16 0.80247 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell death GO:0008219
...
6 Q9H300 PARL 0.80247 catabolic process GO:0009056
cell death GO:0008219
protein targeting GO:0006605
...
7 Q9GZY8 MFF 0.76691 anatomical structure development GO:0048856
cell death GO:0008219
protein targeting GO:0006605
...
8 Q16540 MRPL23 0.76309 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
translation GO:0006412
9 O00471 EXOC5 0.75565 anatomical structure development GO:0048856
cell death GO:0008219
cellular component assembly GO:0022607
...
10 Q96L58 B3GALT6 0.75361 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
small molecule metabolic process GO:0044281

                                           20                  40                  60                  80                 100
AA:                      MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDVCVKIHPSYCGPAILRF
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDD.DDDDDDDDD.....................................................................................
DO_IUPRED2A:             ...................................DDDDDDDDDDDD.D...................................................
DO_SPOTD:                DDDDD....DDDDDDDDDD...DDDD.D.......DDDDDDDDDDDDDD...................................................
CONSENSUS:               DDDDD....DDDDDD....................DDDDDDDDDDDDDD...................................................
CONSENSUS_MOBI:          ....................................................................................................
RICH_[QR]:                                                  QmReaeRQQR                                                       
RICH_[R]:                                                     ReaeRqqReR                                                     
RICH_[ER]:                                                    REaERqqRER                                                     

                                          120                 140                 160                 180     
AA:                      RQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTRQWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD
STMI:                                                                                                                   
DO_DISOPRED3:            ......................................D.DDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DD..........DDD
DO_IUPRED2A:             ....................................DDD.............................DDDDDDD.DDDDDDDDDDDDD.....D
DO_SPOTD:                .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD..DDD.DDDDDD
CONSENSUS:               ....................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....DDD
CONSENSUS_MOBI:          .....................................................................DDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[I]:                                                                          IspfasdIrtI                          
RICH_[R]:                                                       RqwslRpRgslatfktRaR                                     
RICH_[DI]:                                                                               DIrtIseDverD