O00399 DCTN6_HUMAN
Gene name: DCTN6
Protein name: Dynactin subunit 6
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q5SYC1 | CLVS2 | 0.71459 | |
| 2 | Q9NRY2 | INIP | 0.67968 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 3 | Q9Y490 | TLN1 | 0.61793 | biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 4 | P14091 | CTSE | 0.60554 | |
| 5 | P23193 | TCEA1 | 0.60472 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 ... |
| 6 | P49758 | RGS6 | 0.52661 | signal transduction GO:0007165 |
| 7 | Q71UM5 | RPS27L | 0.51452 | biosynthetic process GO:0009058 cell cycle GO:0007049 cell death GO:0008219 ... |
| 8 | Q9UH77 | KLHL3 | 0.48868 | anatomical structure development GO:0048856 catabolic process GO:0009056 cellular protein modification process GO:0006464 ... |
| 9 | Q9NV88 | INTS9 | 0.4769 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 10 | Q9NYS7 | WSB2 | 0.4769 |
20 40 60 80 100 AA: MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIVIGEGNLIEEQALIINAYPDNITPDTEDPEPKPMIIGTNNVFEVGCYSQAMK STMI: DO_DISOPRED3: DDDDDD.............................................................................................. DO_IUPRED2A: ..................................................................DDDDDDDDDDDDDDDDD................. DO_SPOTD: DDDDDD.................................................................DD........................... CONSENSUS: DDDDDD.................................................................DD........................... CONSENSUS_MOBI: DDDDDDD...............................................................DDDDDDDD......................
120 140 160 180 AA: MGDNNVIESKAYVGRNVILTSGCIIGACCNLNTFEVIPENTVIYGADCLRRVQTERPQPQTLQLDFLMKILPNYHHLKKTMKGSSTPVKN STMI: DO_DISOPRED3: .................................................................................DDDDDDDDD DO_IUPRED2A: ......................................................D..........................D..DDDDDD DO_SPOTD: ..............................................................................DDDDDDDDDDDD CONSENSUS: .................................................................................DDDDDDDDD CONSENSUS_MOBI: ...........................................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD RICH_MOBI_[K]: KilpnyhhlKKtmKgsstpvK RICH_MOBI_[L]: LqLdfLmkiLpnyhhL RICH_MOBI_[HL]: LqLdfLmkiLpnyHHL RICH_MOBI_[KL]: LdfLmKiLpnyhhLKKtmK RICH_MOBI_[KM]: MKilpnyhhlKKtMK RICH_MOBI_[LM]: LqLdfLMkiLpnyhhLkktM