List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page

#	UniProt Accession	Gene Name	Cosine Similarity	Generic GO terms
1	Q9Y490	TLN1	0.77206	biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 cell junction organization GO:0034330 ...
2	P14091	CTSE	0.75913
3	P49758	RGS6	0.69297	signal transduction GO:0007165
4	O00399	DCTN6	0.67968
5	A6NCI4	VWA3A	0.61128
6	Q86Y33	CDC20B	0.59233	catabolic process GO:0009056
7	Q5MJ07	SPANXN5	0.57945
8	Q86UT6	NLRX1	0.57524	biological process involved in symbiotic interaction GO:0044403 immune system process GO:0002376 response to stress GO:0006950 ...
9	Q7Z407	CSMD3	0.55042	anatomical structure development GO:0048856 cell differentiation GO:0030154
10	Q9NYS7	WSB2	0.55042

                                           20                  40                  60                  80                 100
AA:                      MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDD..........................DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
DO_IUPRED2A:             DDDDDDDD.....DDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....D.......................
DO_SPOTD:                DDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
CONSENSUS:               DDDDDDDDD..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................
RICH_MOBI_[K]:                       KnrvailaeldKeKrK                                                                        
RICH_MOBI_[L]:                             LaeLdkekrkLL                                                                      
RICH_MOBI_[N]:              NssgqgfqNkN                                                                                      
RICH_MOBI_[KL]:                      KnrvaiLaeLdKeKrKLL                                                                      

                                         
AA:                      LDPE
STMI:                        
DO_DISOPRED3:            ...D
DO_IUPRED2A:             ....
DO_SPOTD:                ..DD
CONSENSUS:               ...D
CONSENSUS_MOBI:          .DDD