Q9NRY2 SOSSC_HUMAN

Gene name: INIP
Protein name: SOSS complex subunit C

List of terms from Generic GO subset, which this protein is a part of:
- cellular nitrogen compound metabolic process GO:0034641
- DNA metabolic process GO:0006259
- response to stress GO:0006950

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 Q9Y490 TLN1 0.77206 biological process involved in symbiotic interaction GO:0044403
cell adhesion GO:0007155
cell junction organization GO:0034330
...
2 P14091 CTSE 0.75913
3 P49758 RGS6 0.69297 signal transduction GO:0007165
4 O00399 DCTN6 0.67968
5 A6NCI4 VWA3A 0.61128
6 Q86Y33 CDC20B 0.59233 catabolic process GO:0009056
7 Q5MJ07 SPANXN5 0.57945
8 Q86UT6 NLRX1 0.57524 biological process involved in symbiotic interaction GO:0044403
immune system process GO:0002376
response to stress GO:0006950
...
9 Q7Z407 CSMD3 0.55042 anatomical structure development GO:0048856
cell differentiation GO:0030154
10 Q9NYS7 WSB2 0.55042

                                           20                  40                  60                  80                 100
AA:                      MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPR
STMI:                                                                                                                        
DO_DISOPRED3:            DDDDDDDDD..........................DDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
DO_IUPRED2A:             DDDDDDDD.....DDDDD.........DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD....D.......................
DO_SPOTD:                DDDDDDDDDDD................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................
CONSENSUS:               DDDDDDDDD..................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD......................................
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................
RICH_MOBI_[K]:                       KnrvailaeldKeKrK                                                                        
RICH_MOBI_[L]:                             LaeLdkekrkLL                                                                      
RICH_MOBI_[N]:              NssgqgfqNkN                                                                                      
RICH_MOBI_[KL]:                      KnrvaiLaeLdKeKrKLL                                                                      

                                         
AA:                      LDPE
STMI:                        
DO_DISOPRED3:            ...D
DO_IUPRED2A:             ....
DO_SPOTD:                ..DD
CONSENSUS:               ...D
CONSENSUS_MOBI:          .DDD