Q71UM5 RS27L_HUMAN
Gene name: RPS27L
Protein name: 40S ribosomal protein S27-like
List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cell cycle GO:0007049
- cell death GO:0008219
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- mitotic cell cycle GO:0000278
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- ribonucleoprotein complex assembly GO:0022618
- ribosome biogenesis GO:0042254
- signal transduction GO:0007165
- translation GO:0006412
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q9Y490 | TLN1 | 0.68866 | biological process involved in symbiotic interaction GO:0044403 cell adhesion GO:0007155 cell junction organization GO:0034330 ... |
| 2 | P49758 | RGS6 | 0.63852 | signal transduction GO:0007165 |
| 3 | O00399 | DCTN6 | 0.51452 | |
| 4 | Q9NRY2 | INIP | 0.50015 | cellular nitrogen compound metabolic process GO:0034641 DNA metabolic process GO:0006259 response to stress GO:0006950 |
| 5 | Q13889 | GTF2H3 | 0.48288 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 6 | P14091 | CTSE | 0.47742 | |
| 7 | Q1RN00 | n/a | 0.4463 | |
| 8 | Q8TF27 | AGAP11 | 0.43066 | |
| 9 | Q9HCI7 | MSL2 | 0.42089 | cellular protein modification process GO:0006464 chromosome organization GO:0051276 |
| 10 | Q9Y4F9 | RIPOR2 | 0.42072 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell adhesion GO:0007155 ... |
20 40 60 80 AA: MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH STMI: DO_DISOPRED3: D..................................................................................D DO_IUPRED2A: ........DDDDDDD..DDDD............................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.......................................DDD.DDDDDDDDDDD CONSENSUS: D.......DDDDDDDDDDDDD..............................................................D CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDDDDD............................................................. RICH_MOBI_[L]: LardLLhpsL RICH_MOBI_[HK]: HpsleeeKKKHKKK RICH_MOBI_[HL]: LLHpsLeeekkkH RICH_MOBI_[KL]: LardLLhpsLeeeKKKhKKK RICH_fLPS_MOBI_[K]: lhpsleeeKKKhKKK