O00585 CCL21_HUMAN

Gene name: CCL21
Protein name: C-C motif chemokine 21

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- biosynthetic process GO:0009058
- cell adhesion GO:0007155
- cell death GO:0008219
- cell differentiation GO:0030154
- cell-cell signaling GO:0007267
- cellular component assembly GO:0022607
- cellular protein modification process GO:0006464
- cytoskeleton organization GO:0007010
- developmental maturation GO:0021700
- homeostatic process GO:0042592
- immune system process GO:0002376
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 H3BMG3 SMKR1 0.86107
2 Q96MM3 ZFP42 0.81321 anatomical structure development GO:0048856
cell cycle GO:0007049
reproduction GO:0000003
3 A6NIV6 LRRIQ4 0.79202
4 P61247 RPS3A 0.77806 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
5 O95995 GAS8 0.7634 anatomical structure development GO:0048856
cell population proliferation GO:0008283
cellular component assembly GO:0022607
...
6 Q15291 RBBP5 0.73316 anatomical structure development GO:0048856
cell differentiation GO:0030154
cellular component assembly GO:0022607
...
7 Q8TF65 GIPC2 0.71475
8 O75367 MACROH2A1 0.71238 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
biosynthetic process GO:0009058
...
9 O60519 CREBL2 0.7098 biosynthetic process GO:0009058
cell cycle GO:0007049
cell differentiation GO:0030154
...
10 Q99075 HBEGF 0.70377 anatomical structure development GO:0048856
biosynthetic process GO:0009058
cell population proliferation GO:0008283
...

                                           20                  40                  60                  80                 100
AA:                      MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPA
STMI:                    SSSSSSSSSSSSSSSSSSSSSSS                                                                             
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDD.........................................................................DDDD
DO_IUPRED2A:             ...........................................D.D.......................................DDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDD..................................................................DDDDDDDD
CONSENSUS:                                      .....................................................................DDDDDDDD
CONSENSUS_MOBI:                                 .............................................................................
RICH_[K]:                                                                                                                 Kpa
RICH_[GK]:                                                                                                                Kpa

                                          120      
AA:                      QGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
STMI:                                                      
DO_DISOPRED3:            DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
RICH_[G]:                 GcrkdrGasktGkkGkGskG             
RICH_[K]:                qgcrKdrgasKtgKKgKgsKgcKrtersqtpK  
RICH_[CG]:                 CrkdrGasktGkkGkGskGC            
RICH_[CK]:                 CrKdrgasKtgKKgKgsKgC            
RICH_[GK]:               qGcrKdrGasKtGKKGKGsKGcKrtersqtpKG 
RICH_fLPS_[K]:              rKdrgasKtgKKgKgsKgcK           
RICH_MOBI_[G]:            GcrkdrGasktGkkGkGskG             
RICH_MOBI_[K]:               KdrgasKtgKKgKgsKgcKrtersqtpK  
RICH_MOBI_[CG]:            CrkdrGasktGkkGkGskGC            
RICH_MOBI_[CK]:            CrKdrgasKtgKKgKgsKgC            
RICH_MOBI_[GK]:           GcrKdrGasKtGKKGKGsKGcKrtersqtpKG 
RICH_fLPS_MOBI_[K]:         rKdrgasKtgKKgKgsKgcK