P61247 RS3A_HUMAN
Gene name: RPS3A
Protein name: 40S ribosomal protein S3a
List of terms from Generic GO subset, which this protein is a part of:
- biological process involved in symbiotic interaction GO:0044403
- biosynthetic process GO:0009058
- catabolic process GO:0009056
- cell death GO:0008219
- cell differentiation GO:0030154
- cellular nitrogen compound metabolic process GO:0034641
- nucleobase-containing compound catabolic process GO:0034655
- protein targeting GO:0006605
- protein transport GO:0015031
- translation GO:0006412
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | A6NIV6 | LRRIQ4 | 0.98138 | |
| 2 | Q99075 | HBEGF | 0.94558 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell population proliferation GO:0008283 ... |
| 3 | O95995 | GAS8 | 0.94225 | anatomical structure development GO:0048856 cell population proliferation GO:0008283 cellular component assembly GO:0022607 ... |
| 4 | H3BMG3 | SMKR1 | 0.916 | |
| 5 | Q15291 | RBBP5 | 0.91556 | anatomical structure development GO:0048856 cell differentiation GO:0030154 cellular component assembly GO:0022607 ... |
| 6 | Q96DY2 | IQCD | 0.90009 | |
| 7 | O75367 | MACROH2A1 | 0.89729 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 biosynthetic process GO:0009058 ... |
| 8 | Q9Y291 | MRPS33 | 0.89571 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 translation GO:0006412 |
| 9 | Q9P0M6 | MACROH2A2 | 0.88807 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell differentiation GO:0030154 ... |
| 10 | Q8IWP9 | CCDC28A | 0.87708 |
20 40 60 80 100 AA: MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNF STMI: DO_DISOPRED3: DDDDDDDDDDDDDDDDDDD................................................................................. DO_IUPRED2A: ....DDDDDDD..D...................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDD............................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDD................................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDDDDD................................................................................ RICH_[K]: KnKrltKggKKgaKK RICH_[GK]: GKnKrltKGG RICH_fLPS_[K]: KnKrltKggKKgaKK RICH_MOBI_[K]: KnKrltKggKKgaKKK RICH_MOBI_[GK]: GKnKrltKGGKKGaKKK RICH_fLPS_MOBI_[K]: mavgKnKrltKggKKgaKKK
120 140 160 180 200 AA: HGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKA STMI: DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ....................................................DDDDD........................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ....................................................................................................
220 240 260 AA: CQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQESV STMI: DO_DISOPRED3: .....................................DDDDDDDDDDDDDDD.DDDDDD.DDDD DO_IUPRED2A: .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD DO_SPOTD: .....................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS: .................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD CONSENSUS_MOBI: ..................................DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD