O14558 HSPB6_HUMAN
Gene name: HSPB6
Protein name: Heat shock protein beta-6
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell death GO:0008219
- protein folding GO:0006457
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
---|---|---|---|---|
1 | P17010 | ZFX | 0.66826 | anatomical structure development GO:0048856 |
2 | Q9UL63 | MKLN1 | 0.66826 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell morphogenesis GO:0000902 ... |
3 | Q9BTE1 | DCTN5 | 0.60536 | |
4 | Q04446 | GBE1 | 0.60129 | biosynthetic process GO:0009058 carbohydrate metabolic process GO:0005975 generation of precursor metabolites and energy GO:0006091 |
5 | A6NMB1 | SIGLEC16 | 0.5603 | cell adhesion GO:0007155 immune system process GO:0002376 response to stress GO:0006950 |
6 | Q6DD88 | ATL3 | 0.53889 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
7 | Q8N4F7 | RNF175 | 0.53461 | catabolic process GO:0009056 response to stress GO:0006950 signal transduction GO:0007165 |
8 | Q7RTP0 | NIPA1 | 0.50917 | transmembrane transport GO:0055085 transport GO:0006810 |
9 | Q96S52 | PIGS | 0.50499 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
10 | Q9HCM9 | TRIM39 | 0.49671 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
20 40 60 80 100 AA: MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVH STMI: DO_DISOPRED3: D.........................................................D......................................... DO_IUPRED2A: ..................................................................................................DD DO_SPOTD: .................................................................................................... CONSENSUS: .................................................................................................... CONSENSUS_MOBI: ......................................DDDDDDDDDDDDDDDDD............................................. RICH_MOBI_[AL]: LAALcpttLA RICH_MOBI_[LY]: LaaLcpttLapYYL
120 140 AA: ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK STMI: DO_DISOPRED3: ........DDDDDD...................................DDDDDDDDDDD DO_IUPRED2A: DDDDDD.DDDDD................DD..............DDDDDDDDDDDDDDDD DO_SPOTD: .................................................DDDDDDDDDDD CONSENSUS: ........DDDD.....................................DDDDDDDDDDD CONSENSUS_MOBI: ............................................................ RICH_fLPS_[A]: sAqApppAAA