O14558 HSPB6_HUMAN

Gene name: HSPB6
Protein name: Heat shock protein beta-6

List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- anatomical structure formation involved in morphogenesis GO:0048646
- cell death GO:0008219
- protein folding GO:0006457

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 P17010 ZFX 0.66826 anatomical structure development GO:0048856
2 Q9UL63 MKLN1 0.66826 anatomical structure development GO:0048856
cell adhesion GO:0007155
cell morphogenesis GO:0000902
...
3 Q9BTE1 DCTN5 0.60536
4 Q04446 GBE1 0.60129 biosynthetic process GO:0009058
carbohydrate metabolic process GO:0005975
generation of precursor metabolites and energy GO:0006091
5 A6NMB1 SIGLEC16 0.5603 cell adhesion GO:0007155
immune system process GO:0002376
response to stress GO:0006950
6 Q6DD88 ATL3 0.53889 cellular component assembly GO:0022607
protein-containing complex assembly GO:0065003
7 Q8N4F7 RNF175 0.53461 catabolic process GO:0009056
response to stress GO:0006950
signal transduction GO:0007165
8 Q7RTP0 NIPA1 0.50917 transmembrane transport GO:0055085
transport GO:0006810
9 Q96S52 PIGS 0.50499 biosynthetic process GO:0009058
cellular protein modification process GO:0006464
10 Q9HCM9 TRIM39 0.49671 catabolic process GO:0009056
cell cycle GO:0007049
cell death GO:0008219
...

                                           20                  40                  60                  80                 100
AA:                      MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVH
STMI:                                                                                                                        
DO_DISOPRED3:            D.........................................................D.........................................
DO_IUPRED2A:             ..................................................................................................DD
DO_SPOTD:                ....................................................................................................
CONSENSUS:               ....................................................................................................
CONSENSUS_MOBI:          ......................................DDDDDDDDDDDDDDDDD.............................................
RICH_MOBI_[AL]:                                                   LAALcpttLA                                                 
RICH_MOBI_[LY]:                                                   LaaLcpttLapYYL                                             

                                          120                 140
AA:                      ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK
STMI:                                                                                
DO_DISOPRED3:            ........DDDDDD...................................DDDDDDDDDDD
DO_IUPRED2A:             DDDDDD.DDDDD................DD..............DDDDDDDDDDDDDDDD
DO_SPOTD:                .................................................DDDDDDDDDDD
CONSENSUS:               ........DDDD.....................................DDDDDDDDDDD
CONSENSUS_MOBI:          ............................................................
RICH_fLPS_[A]:                                                            sAqApppAAA