Q9BTE1 DCTN5_HUMAN
Gene name: DCTN5
Protein name: Dynactin subunit 5
List of terms from Generic GO subset, which this protein is a part of:
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O14558 | HSPB6 | 0.60536 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell death GO:0008219 ... |
| 2 | Q9H1V8 | SLC6A17 | 0.43295 | anatomical structure development GO:0048856 circulatory system process GO:0003013 transport GO:0006810 |
| 3 | P02818 | BGLAP | 0.38743 | anatomical structure development GO:0048856 cell adhesion GO:0007155 cell differentiation GO:0030154 ... |
| 4 | P51948 | MNAT1 | 0.35996 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 cell cycle GO:0007049 ... |
| 5 | O75396 | SEC22B | 0.35553 | |
| 6 | Q96MI9 | AGBL1 | 0.31796 | cellular protein modification process GO:0006464 |
| 7 | P29992 | GNA11 | 0.30264 | |
| 8 | Q9NRF8 | CTPS2 | 0.28502 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 small molecule metabolic process GO:0044281 |
| 9 | Q8N136 | DAW1 | 0.26567 | |
| 10 | Q16082 | HSPB2 | 0.24955 | response to stress GO:0006950 |
20 40 60 80 100 AA: MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRHCVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVN STMI: DO_DISOPRED3: DD.................................................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDD................................................................................................ CONSENSUS: DD.................................................................................................. CONSENSUS_MOBI: DDDDDDDDDDDDDDDDD................................................................................... RICH_MOBI_[LY]: LgeLLYnkseY
120 140 160 180 AA: AAQIGSYVHVGKNCVIGRRCVLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLTQV STMI: DO_DISOPRED3: .................................................................................. DO_IUPRED2A: .................................................................................. DO_SPOTD: .................................................................................. CONSENSUS: .................................................................................. CONSENSUS_MOBI: ..................................................................................