Q7RTP0 NIPA1_HUMAN
Gene name: NIPA1
Protein name: Magnesium transporter NIPA1
List of terms from Generic GO subset, which this protein is a part of:
- transmembrane transport GO:0055085
- transport GO:0006810
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | Q96S52 | PIGS | 0.99995 | biosynthetic process GO:0009058 cellular protein modification process GO:0006464 |
| 2 | Q9HCM9 | TRIM39 | 0.9996 | catabolic process GO:0009056 cell cycle GO:0007049 cell death GO:0008219 ... |
| 3 | Q9UFG5 | C19orf25 | 0.99892 | |
| 4 | Q08AG7 | MZT1 | 0.99892 | cell cycle GO:0007049 cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 ... |
| 5 | P0DMW5 | SMIM10L2B | 0.99847 | |
| 6 | Q8N4F7 | RNF175 | 0.99814 | catabolic process GO:0009056 response to stress GO:0006950 signal transduction GO:0007165 |
| 7 | Q6DD88 | ATL3 | 0.99743 | cellular component assembly GO:0022607 protein-containing complex assembly GO:0065003 |
| 8 | Q9NUP9 | LIN7C | 0.99673 | anatomical structure development GO:0048856 cell-cell signaling GO:0007267 protein transport GO:0015031 ... |
| 9 | Q96MZ0 | GDAP1L1 | 0.99673 | |
| 10 | Q9NVX2 | NLE1 | 0.99673 | anatomical structure development GO:0048856 anatomical structure formation involved in morphogenesis GO:0048646 cell cycle GO:0007049 ... |
20 40 60 80 100 AA: MGTAAAAAAAAAAAAAGEGARSPSPAAVSLGLGVAVVSSLVNGSTFVLQKKGIVRAKRRGTSYLTDIVWWAGTIAMAVGQIGNFLAYTAVPTVLVTPLGA STMI: MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMM DO_DISOPRED3: DDDDDDDDDDDDDDDDDDDDDDD............................................................................. DO_IUPRED2A: .................................................................................................... DO_SPOTD: DDDDDDDDDDDDDDDDDDDDDDDDDDDD........................................................................ CONSENSUS: DDDDDDDDDDDDDDDDDDDDDDD.... .................. . CONSENSUS_MOBI: ........................... .................. . RICH_[A]: AAAAAAAAAAAAAgegA RICH_fLPS_[A]: mgtAAAAAAAAAAAAAgegA
120 140 160 180 200 AA: LGVPFGSILASYLLKEKLNILGKLGCLLSCAGSVVLIIHSPKSESVTTQAELEEKLTNPVFVGYLCIVLLMLLLLIFWIAPAHGPTNIMVYISICSLLGS STMI: MMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: ................................................D................................................... DO_SPOTD: .................................................................................................... CONSENSUS: ........ ..................... ... CONSENSUS_MOBI: ........ ..................... ...
220 240 260 280 300 AA: FTVPSTKGIGLAAQDILHNNPSSQRALCLCLVLLAVLGCSIIVQFRYINKALECFDSSVFGAIYYVVFTTLVLLASAILFREWSNVGLVDFLGMACGFTT STMI: MMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMMMMMMMMMMMMM MMMMMMMMMM DO_DISOPRED3: .................................................................................................... DO_IUPRED2A: .................................................................................................... DO_SPOTD: .................................................................................................... CONSENSUS: .................... .............. .......... CONSENSUS_MOBI: .................... .............. ..........
320 AA: VSVGIVLIQVFKEFNFNLGEMNKSNMKTD STMI: MMMMMMMMMMM DO_DISOPRED3: .................D.DDDDDDDDDD DO_IUPRED2A: ............................D DO_SPOTD: ..................DDDDDDDDDDD CONSENSUS: ........DDDDDDDDDD CONSENSUS_MOBI: ..................