Q14331 FRG1_HUMAN
Gene name: FRG1
Protein name: Protein FRG1
List of terms from Generic GO subset, which this protein is a part of:
- anatomical structure development GO:0048856
- cellular nitrogen compound metabolic process GO:0034641
- mRNA processing GO:0006397
- ribosome biogenesis GO:0042254
Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
| # | UniProt Accession | Gene Name | Cosine Similarity | Generic GO terms |
|---|---|---|---|---|
| 1 | O14818 | PSMA7 | 0.94763 | anatomical structure development GO:0048856 biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 ... |
| 2 | Q9BYD6 | MRPL1 | 0.92887 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 ribosome biogenesis GO:0042254 ... |
| 3 | O14604 | TMSB4Y | 0.92468 | cellular component assembly GO:0022607 cytoskeleton organization GO:0007010 protein-containing complex assembly GO:0065003 |
| 4 | Q05901 | CHRNB3 | 0.88592 | cell-cell signaling GO:0007267 nervous system process GO:0050877 signal transduction GO:0007165 ... |
| 5 | P46721 | SLCO1A2 | 0.85878 | transport GO:0006810 |
| 6 | P62328 | TMSB4X | 0.85861 | biosynthetic process GO:0009058 cellular component assembly GO:0022607 cellular nitrogen compound metabolic process GO:0034641 ... |
| 7 | P61254 | RPL26 | 0.84301 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 8 | Q5FWF6 | ZNF789 | 0.83627 | biosynthetic process GO:0009058 cellular nitrogen compound metabolic process GO:0034641 |
| 9 | P42677 | RPS27 | 0.82409 | biological process involved in symbiotic interaction GO:0044403 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
| 10 | Q8TAA3 | PSMA8 | 0.7941 | anatomical structure development GO:0048856 biosynthetic process GO:0009058 catabolic process GO:0009056 ... |
20 40 60 80 100 AA: MAEYSYVKSTKLVLKGTKTKSKKKKSKDKKRKREEDEETQLDIVGIWWTVTNFGEISGTIAIEMDKGTYIHALDNGLFTLGAPHKEVDEGPSPPEQFTAV STMI: DO_DISOPRED3: DD............DDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ DO_IUPRED2A: ..................D...DDDDDDDDDDDDDD..............................................DDDDDDDDDDDDDDDDD. DO_SPOTD: DDDDDDDDDDDDD.DDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS: DD............DDDDDDDDDDDDDDDDDDDDDDDDDD............................................................ CONSENSUS_MOBI: .................................................................................................... RICH_[K]: KgtKtKsKKKKsKdKKrK RICH_[EK]: KsKKKKsKdKKrKrEEdEE RICH_fLPS_[K]: KgtKtKsKKKKsKdKKrKre
120 140 160 180 200 AA: KLSDSRIALKSGYGKYLGINSDGLVVGRSDAIGPREQWEPVFQNGKMALLASNSCFIRCNEAGDIEAKSKTAGEEEMIKIRSCAERETKKKDDIPEEDKG STMI: DO_DISOPRED3: ............................................................................................DDDDDDDD DO_IUPRED2A: .............................D.....DDD...............................D............D.....DDDDDDDDDD.. DO_SPOTD: ......................................................................................DDDDDDDDDDDDDD CONSENSUS: ........................................................................................DDDDDDDDDDDD CONSENSUS_MOBI: .................................................................................................... RICH_[DK]: KKKDDipeeDK
220 240 AA: NVKQCEINYVKKFQSFQDHKLKISKEDSKILKKARKDGFLHETLLDRRAKLKADRYCK STMI: DO_DISOPRED3: DD........................................................ DO_IUPRED2A: .......................................................... DO_SPOTD: DD.................................................DDDDDDD CONSENSUS: DD........................................................ CONSENSUS_MOBI: ..........................................................