P62328 TYB4_HUMAN

Gene name: TMSB4X
Protein name: Thymosin beta-4

List of terms from Generic GO subset, which this protein is a part of:
- biosynthetic process GO:0009058
- cellular component assembly GO:0022607
- cellular nitrogen compound metabolic process GO:0034641
- cytoskeleton organization GO:0007010
- protein-containing complex assembly GO:0065003
- response to stress GO:0006950
- signal transduction GO:0007165
- small molecule metabolic process GO:0044281
- transmembrane transport GO:0055085
- transport GO:0006810
- vesicle-mediated transport GO:0016192

Table: Top 10 the most similar proteins, based on disordered regions enriched in particular amino acids. Cosine similarity calculation is described here. The whole list can be downloaded at the Download page
# UniProt Accession Gene Name Cosine Similarity Generic GO terms
1 O14604 TMSB4Y 0.95097 cellular component assembly GO:0022607
cytoskeleton organization GO:0007010
protein-containing complex assembly GO:0065003
2 Q5FWF6 ZNF789 0.94378 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
3 Q9BYD6 MRPL1 0.9339 biosynthetic process GO:0009058
cellular nitrogen compound metabolic process GO:0034641
ribosome biogenesis GO:0042254
...
4 O14818 PSMA7 0.91493 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
5 P21246 PTN 0.87946 anatomical structure development GO:0048856
anatomical structure formation involved in morphogenesis GO:0048646
cell adhesion GO:0007155
...
6 P49917 LIG4 0.87746 anatomical structure development GO:0048856
biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
...
7 Q8NEL0 CCDC54 0.87468
8 Q9HAW9 UGT1A8 0.87034 carbohydrate metabolic process GO:0005975
small molecule metabolic process GO:0044281
9 P62979 RPS27A 0.87034 biological process involved in symbiotic interaction GO:0044403
biosynthetic process GO:0009058
catabolic process GO:0009056
...
10 Q14331 FRG1 0.85861 anatomical structure development GO:0048856
cellular nitrogen compound metabolic process GO:0034641
mRNA processing GO:0006397
...

                                           20                  40                
AA:                      MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
STMI:                                                                
DO_DISOPRED3:            DDDDD..DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD.DDDD
DO_IUPRED2A:             DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
DO_SPOTD:                DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS:               DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
CONSENSUS_MOBI:          D........................................DDD
RICH_[K]:                   KpdmaeieKfdKsKlKKtetqeKnplpsKetieqeK     
RICH_[DM]:               MsDkpDMaeiekfD                              
RICH_[EK]:                       EiEKfdKsKlKKtEtqEK                  
RICH_fLPS_[K]:                     eKfdKsKlKKtetqeKnplpsK